KEGG   Thermodesulfatator indicus: Thein_2165Help
Entry
Thein_2165        CDS       T01546                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00030  Pentose phosphate pathway
tid00051  Fructose and mannose metabolism
tid00052  Galactose metabolism
tid00230  Purine metabolism
tid00500  Starch and sucrose metabolism
tid00520  Amino sugar and nucleotide sugar metabolism
tid00521  Streptomycin biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_2165
   00030 Pentose phosphate pathway
    Thein_2165
   00051 Fructose and mannose metabolism
    Thein_2165
   00052 Galactose metabolism
    Thein_2165
   00500 Starch and sucrose metabolism
    Thein_2165
   00520 Amino sugar and nucleotide sugar metabolism
    Thein_2165
  Nucleotide metabolism
   00230 Purine metabolism
    Thein_2165
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thein_2165
Enzymes [BR:tid01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Thein_2165
    5.4.2.8  phosphomannomutase
     Thein_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218 DUF4358
Motif
Other DBs
NCBI-ProteinID: AEH46013
UniProt: F8ADQ5
Position
complement(2244659..2246023)
Genome map
AA seq 454 aa AA seqDB search
MKVNPLMFREYDIRGRVDEDLTVEVAEAIGKAYGTMVKRAGGKKVVSGRDGRLSGPKLQE
ALIRGILSTGINVVNIGVTPTPVMYFSLFTLEGIDGGIQVTGSHNPPEFNGFKICLGKET
LYGPKIQKIRKLIEKEDFETGTGNLEEYDILPSYLKYLKENIKVSRSLKVVLDCGNGVTA
LTAPYAFRDQGCEVTSLYCEVDGTFPNHFPDPTVEENIKDLREKVLEIGADFGVGYDGDG
DRIGVVDDKGKILWGDQLLIIFAREILKERPGATIIGEVKCSQVMYDEIARLGGKPIMWK
TGHSLIKGKMKEEKAVLAGEMSGHLFFADRFFGFDDAVYASLRLAEIVAKSDVPLSEMLK
DLPKMVSTPEIRVECPDDKKFEIVRRLTEKLKAEGLNVIDIDGARVIFEDGWGLVRASNT
QPVLVLRFEAKDEKRLEEIRRFIEERLEQVKQEV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaatccgctcatgtttagggaatatgacatacgcggccgggttgatgaagac
ttaaccgtagaagtggctgaagccattggcaaggcctacggcactatggtaaaacgcgct
ggcggcaaaaaggtcgtctctggccgtgacggtcgtctttctggcccaaaactccaggag
gcccttatccgcggtatcctttccaccggtataaatgtagtcaacatcggtgtaactccc
acaccggttatgtatttttcgctttttacgcttgaagggatagacggaggtattcaggta
accggctctcacaacccaccagagtttaacggttttaaaatctgcctcggtaaagaaacc
ctttatggccctaaaattcagaaaattagaaaattaatagaaaaagaagacttcgaaacc
ggaactggaaatttagaagagtacgatattttacctagttatcttaaatacttaaaggaa
aacattaaagtttcccgctctcttaaagtggtgcttgattgcggcaacggggtaacagcc
cttacggcgccgtatgcctttcgggatcagggttgtgaagttacttctctttattgtgaa
gtagatggcacttttcctaatcactttcctgatcctacggttgaagaaaacatcaaagac
ttgcgtgagaaggtgcttgaaattggtgctgatttcggtgtgggctacgatggtgatggg
gaccgcattggcgtggttgatgataaaggaaagatcctctggggagaccagcttctcata
atctttgcccgtgagattttgaaagaaaggcccggagccaccatcattggcgaggtcaag
tgttcacaggttatgtatgacgaaatagctcgccttggcgggaaacctattatgtggaaa
accggccattcgcttattaaaggcaaaatgaaagaagaaaaagccgttttggctggtgaa
atgagtgggcatctcttttttgctgacaggttcttcggttttgatgatgcagtttacgcc
tctttacggctggctgagattgtagccaaatcagatgttcctctctcagagatgctaaag
gaccttcccaagatggtttctacccctgaaataagggttgaatgccctgatgataaaaag
tttgagattgtgcgtcgtttaacggaaaaacttaaggccgaaggcctaaatgttattgat
attgacggtgccagggtgatttttgaagacggctgggggcttgtgcgagcttcaaatacc
cagccggtgttagtgcttcgttttgaggccaaagatgaaaaacgacttgaagaaatcagg
cgcttcattgaagaaaggcttgagcaggtaaagcaagaagtttaa

DBGET integrated database retrieval system