KEGG   Thiomonas intermedia: Tint_0098Help
Entry
Tint_0098         CDS       T01227                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
tin  Thiomonas intermedia
Brite
Enzymes [BR:tin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Tint_0098
Transfer RNA biogenesis [BR:tin03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Tint_0098
 Prokaryotic Type
    Tint_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
104023..104469
Genome map
AA seq 148 aa AA seqDB search
MNRRCIRSTLQSLFFAGLLIATSSLLASGGTSVWPAAQARETSQSSQTSALQDIPVISVA
DLPVQARDMLKRIEQGGPFEGYKDGVIFGNYERLLPSKRRGYYREYTVPTPGARNRGARR
IVCGGAKHHPDVCYYTHDHYASFRRIAQ
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccggtgcattcgttctacgctgcaatccctgttttttgcggggctgctgatt
gccacttcgtcgcttctggcatcaggcggaaccagcgtgtggcctgcagcccaggcgcgc
gaaacgtcgcaatcgtcgcaaacctcggcactgcaggacattccagtcatttccgtggcc
gacctgccggtgcaggcgcgagacatgttgaagcgcattgaacaaggcggcccgttcgag
ggatacaaggacggcgtcatttttggaaactatgagcggcttttgccctcaaaacgtcgt
ggttattaccgcgaatacaccgtcccgactccaggcgcccgcaaccgaggggcgcgccgc
attgtttgcggaggggccaagcaccatcccgatgtttgttactacacccatgatcactat
gccagtttccgacgcatcgcccaatga

DBGET integrated database retrieval system