KEGG   Thiomonas intermedia: Tint_0292Help
Entry
Tint_0292         CDS       T01227                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tin  Thiomonas intermedia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tint_0292
Enzymes [BR:tin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tint_0292
Exosome [BR:tin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tint_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(311860..312873)
Genome map
AA seq 337 aa AA seqDB search
MKNFVNLPGFPGTRMRRLRRDDFSRRLVREHRLSADDLIYPVFILDGENQRQSVASMPGV
ERLSVDLLLPVAEECVKLGIPVLALFPVIDPKLKTPDGIEAANPDGLVPRAVRALKAAFP
QLGVLTDVALDPYTSHGQDGLLDDTGYIMNEPTVAMLVKQALAQAAAGVDIVAPSDMMDG
RIGAIRQALEADSHIHTRIMAYSAKYASAFYGPFRDAVGSAANLGKADKKVYQMDPGNSD
EALREVALDIAEGADMVMVKPGMPYLDIVRRVKDEFHMPTFAYQVSGEYAMLKAAAQNGW
LDHDAVMMESLLAFKRAGADGILTYFAVEAARKLRQG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttgtgaacctgcccggatttcccggcacccgcatgcggcgtttgcgccgc
gacgacttcagccgccgtctagtgcgcgagcaccgactgtccgcggacgatctgatctac
ccggtgttcatcctcgatggcgagaaccagcgccagagcgtggcgtcgatgcccggcgtg
gagcgtttgagtgttgatctgctgctgccggtggccgaggaatgcgtgaaactgggcatt
ccggtgctggcgctgtttcccgtgatcgatcccaagctcaagacgcccgacggcatcgag
gccgccaaccccgacggactggtgccccgagcggtgcgcgcgctcaaagcggcgtttcca
cagctcggtgtgctcaccgatgtggcgctcgacccctacacctcacacggccaggacggt
ctgctcgacgacaccggctacatcatgaacgagcccaccgtggccatgctggtgaagcag
gcgctggcgcaggccgccgccggagtggacatcgtcgccccaagcgacatgatggacggc
cgcatcggcgcgatccgccaggcgctggaggccgacagccatattcacacccgcatcatg
gcctacagcgccaagtacgccagcgcgttctacggcccgttccgcgacgccgtgggctcg
gccgccaacctcggcaaggccgacaaaaaggtctatcagatggacccgggcaactccgac
gaagcgctgcgcgaagtggcgctcgacatcgccgagggcgccgacatggtgatggtcaaa
ccgggcatgccgtatctcgacatcgtgcgccgggttaaggacgagttccacatgccgact
ttcgcttatcaagtgagcggcgaatacgccatgctcaaggcagccgcgcaaaacggctgg
ctcgaccatgacgcggtgatgatggaaagcctgctggcattcaaacgcgcgggggccgac
ggcatcctcacctatttcgccgtcgaggcggcgcgcaagttgcggcaaggctga

DBGET integrated database retrieval system