KEGG   Thiomonas intermedia: Tint_0302Help
Entry
Tint_0302         CDS       T01227                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tin  Thiomonas intermedia
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tint_0302
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tint_0302
   00650 Butanoate metabolism
    Tint_0302
  Lipid metabolism
   00071 Fatty acid degradation
    Tint_0302
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tint_0302
   00310 Lysine degradation
    Tint_0302
   00360 Phenylalanine metabolism
    Tint_0302
   00380 Tryptophan metabolism
    Tint_0302
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tint_0302
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tint_0302
   00281 Geraniol degradation
    Tint_0302
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tint_0302
   00627 Aminobenzoate degradation
    Tint_0302
   00930 Caprolactam degradation
    Tint_0302
Enzymes [BR:tin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tint_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(321248..322033)
Genome map
AA seq 261 aa AA seqDB search
METPDDAVVLTETRGHVGLITLNRPKQLNALNDALMDALGAALKAFDADPAIGCMVVTGS
DKAFAAGADITAMAKKTFPASYTEDFITRNWEAMMQIRKPVIAAVRGFALGGGCELAMMC
DLIVAADNAQFGQPEIKLGIIPGAGGTQRLTRAVGKAKAMDLILTGRMMDALEAERSGLV
ARVVPLQQTLDEAVAMAETISSFSQASVLMAKESVNRAFDSSLSEGLRFERRLFQSLFAT
ADQKEGMAAFLEKRKPLFTNK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggagacccctgacgacgccgtcgtcctcaccgaaacccgaggccacgtcggcctcatc
accctcaatcgacccaagcaactcaacgccctgaacgacgctctgatggacgcgctgggc
gccgcgctcaaagcgtttgacgctgatccggccatcggctgcatggtcgtcaccggcagc
gacaaggctttcgccgccggggccgacatcaccgccatggcgaaaaagacctttcccgcc
agctacaccgaagacttcatcacccgcaactgggaagcgatgatgcagattcgcaagccg
gtgattgcggcggtgcgcggcttcgcgctgggcgggggctgcgagctggcgatgatgtgc
gatctcatcgtcgccgccgacaacgcccagttcggccagcccgaaatcaagctcggcatc
attcccggcgccggcggcacccagcggctgacgcgcgccgtgggcaaagccaaggccatg
gatctgatcctcaccggccggatgatggacgcgcttgaggccgagcgcagcggcctggtc
gcgcgggtcgtgccgctgcagcagacactcgatgaggccgtggcgatggccgaaaccatt
tccagcttctcgcaggcttcggtgctcatggccaaggagagcgtgaaccgcgcgtttgac
tcgtcgctgtccgaaggtttgcgtttcgagcgtcggctgtttcagtcgctgttcgctacg
gctgaccagaaggagggtatggcggctttcctggaaaaacgaaaaccgcttttcacgaac
aaatga

DBGET integrated database retrieval system