KEGG   Thiomonas intermedia: Tint_0346Help
Entry
Tint_0346         CDS       T01227                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tin  Thiomonas intermedia
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tin00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
372010..373041
Genome map
AA seq 343 aa AA seqDB search
MRALFNLPAPAKINWFLHVTGKRPDGYHTLQTVFQFIDWCDTLDLIQRDDGLIRRIGADE
LPQDDLCVRAARLLQQATQCESGVDIHLRKCIPQQAGLGGGSSDAATVLIGLNRLWRLDL
PRAKLMQLALQLGADVPIFIYGRNAWAEGVGEQLQPIDLPTPSFAVVHPARGLSTRAVFS
TLDLTTKKPEETIAGFAEWLGEFFAPDGRQKNRHQKSQSKNCLQDDQQSSLCPVWGRNDL
QPGAEVLEPEVTQALQILRTALMGPLAAHSPTLRSELLFDARMTGSGSAVFALIGASDRS
GLPSRHGPSDEVLGGLPDLLPEGWQGRLCEGLREHPLCDWIDA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccttgttcaatctgcccgccccggcgaaaatcaactggtttttgcacgtcacc
ggcaagcgcccagacggctatcacaccctgcagacggtctttcagttcatcgattggtgc
gacacgctcgatctgatccagcgtgacgatggcctcatccgccgcatcggcgctgacgaa
ctgccgcaagacgacctttgcgtgcgcgccgcccgcctgctccaacaggcgacgcagtgc
gaaagcggcgtcgatatccatctgcgcaagtgcattccgcaacaggccgggctcggcggc
ggaagttccgatgctgccacggtactgatcggcctcaaccgtctctggcgcctcgatctg
ccgcgcgccaaactgatgcaactcgccttgcaactcggcgccgacgtgccgattttcatc
tacggccgcaacgcctgggccgagggcgtcggcgagcagttgcagccaatcgatctgccc
acgcccagttttgctgtggtgcatccggcacgcggcctgtccacacgtgcggtgttttcc
acccttgacttgacaaccaaaaaacccgaagaaacaatagcaggctttgctgaatggctg
ggcgaatttttcgcgccagacgggcggcagaaaaatcggcaccagaaaagtcagagcaaa
aactgtctacaagacgatcagcaaagcagtctttgccctgtctggggcagaaacgatttg
cagcccggcgccgaggtgctggagcctgaggtgactcaggcactgcagattttgcgtact
gcgttgatggggccgctggcagcacactcgccgacgttgcgttctgagttgcttttcgac
gcgcgaatgacgggttctggcagcgcagtttttgctttgatcggtgcgtcagatcgatct
ggtttgccgagcaggcacgggccgtctgatgaggtgttgggtggtttgccggacttgttg
cctgagggttggcagggccggttgtgcgagggtttgcgcgagcatccgttgtgcgattgg
attgacgcataa

DBGET integrated database retrieval system