KEGG   Thiomonas intermedia: Tint_0361Help
Entry
Tint_0361         CDS       T01227                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
tin  Thiomonas intermedia
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tint_0361
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tint_0361
Enzymes [BR:tin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Tint_0361
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Tint_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
387082..390009
Genome map
AA seq 975 aa AA seqDB search
MNHTPKAVDTVLQALRALGVAADATWTADSRSLQPGEVFVAWPGAARDPRQFVAQALAAG
AAAALVEAEGAQYFGFTDPRILAVDGLKALAGPLAAAWYGHPSEVVKLLAVTGTNGKTSC
ALWAAQALNAAGQRCGVIGTLGAGWPDALQPTGFTTPDPVRLQTILARLREQGALWCAIE
ASSIGLDEHRLAGCAIHAAAFTNLTQDHLDYHGDMAAYARAKRALFVWPGLQHAVLDIDD
PYAASVLLADCRSRGQQVQTTALIAKADWCAEDVVQTSTGQRLTLVHHHHRHALDLPVLG
AFNLRNLLVVAALLHTTGLDDAAIAAALRTVRAVPGRMQMLGGIGAPLAVIDYAHTPDAL
YKALQALRPVTAKRKGKLWCVFGAGGDRDARKRPLMAQAAEAHADRVVLTSDNPRSEAPG
AILQDLLAGLQQPAQALLIEDRAAAIAQTLSHAAVHDVVLIAGKGHENTQEIAGHKQAFS
DAFHARMALAARDAGLCSLGELRDWIGPEARLIGEADVAVSAIETDSRKLTPGALFVALR
GARFDAHDFLPQAAAAGARALLAEQGVAACGLPGIEAPDTLRAFGLLARGWRRQQTLPLI
AVTGSNGKTTVTQMLASILAAWQGQDRRLATQGNFNNEVGLPLTLLRLRPQHQAAVVELG
MNHPGEIAWLASLAEPTVALVNNAQREHQEFMHSVEAVAHENGSVLAALPQTGVAVFPAD
DAQTAIWVAQAAGRRVLRFALREGAEAGVEAEVSGHAFYRQGQLRLQLHTPTGHAEVGLQ
LLGRHNARNALAATAAALAAGAPLDAICRGLEAFAPVAGRLVPRRLRCADDRTLLLIDDS
YNANPDSVRAAIDVLAELPGRSLLLLGDMGEVGDNGPAFHAEVGTYAAQRGVAALWACGA
MTAQAVAAAQAAGLAAAKHQPDLMDFTLDAAALREFDTVLVKGSRFMRMERAVQAIAALA
ANGNGASTQEVHHAA
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacacgccgaaagcggtcgataccgtgctgcaagcgttgcgcgccttgggcgtc
gcggccgatgcgacgtggaccgccgacagccgcagcctgcagcccggcgaggtgttcgtc
gcctggccgggggcggcgcgcgatccgcgtcagttcgtggcgcaggccttggcggcgggg
gcagcggccgcgctagtcgaggccgagggcgcgcagtattttggcttcaccgatccacgc
attctggctgttgacgggctcaaggcgctggccgggccgcttgcggcggcctggtacgga
catccttccgaggtcgtcaagctgctggccgtgaccggcaccaatggcaagacctcctgc
gctttgtgggcagcgcaggccctgaatgcggctgggcagcgctgcggggtgatcggcacg
ctgggcgccggatggccggacgcgctgcagcccaccggattcaccacgcccgacccggta
cgtctgcagacgatcctggcgcggctgcgcgagcaaggcgcgctctggtgcgccatcgag
gcatcgagcatcggcctggacgaacatcggctggcgggttgcgctattcatgcggccgca
ttcaccaatctgacgcaagaccatctcgactaccacggcgacatggcggcctatgcgcgc
gccaagcgggcgctgttcgtctggccggggctgcagcatgccgtactggatatcgacgat
ccctacgccgcaagcgtcttgctcgccgattgccgcagccgggggcagcaggtgcaaacc
accgcgctgatcgccaaggccgactggtgtgcggaagacgtggtgcagacttccaccggc
cagcgtctcactctggtgcatcaccaccatcgccacgcgctggatctgcccgtgctgggc
gccttcaacctgcgcaatttgctggtggttgccgcgctgctgcacaccacggggctggat
gacgccgccattgccgccgccttgcgcacggtgcgcgcggtgccggggcgcatgcagatg
ctgggcggcatcggtgcgccgctggcggtcatcgactacgcccacacgcccgacgcgctg
tacaaagcgcttcaagcgctgcggcctgtcaccgccaagcgcaaaggcaagttgtggtgc
gtgttcggcgccggcggcgaccgcgatgcgcgcaaacgcccgctgatggcacaggccgcc
gaggctcacgccgaccgcgtggtactcaccagcgacaacccacgcagcgaagcgccaggc
gccatcctgcaagatctgctcgccggtctgcagcaacccgcacaagccctgctgatcgaa
gaccgcgccgccgccatcgcccagaccctgtcgcacgccgctgtgcacgacgtggtgctc
atcgcgggcaaggggcacgaaaacacgcaagagatcgccggacacaagcaggccttcagc
gacgccttccatgcccgcatggcactggccgcgcgcgacgcagggctttgcagcctgggc
gaattgcgcgactggatcgggcccgaggcccgcctcatcggcgaggccgacgtggcggtg
agcgccatcgagaccgacagccgcaaactcacgccgggcgcgctgttcgtcgccttgcgc
ggcgcccgcttcgatgcgcacgactttctgccgcaggcagcggccgctggcgcgcgcgcc
ctgctggccgagcaaggcgtggccgcttgcgggctgccgggcatcgaggcgcccgacacc
ctgcgcgcttttggtctgttggcgcgaggctggcggcgccagcagacgttgccgctgatc
gcggtgaccggcagcaacggcaagaccacggtgacgcagatgctcgcaagcattctggcg
gcgtggcagggccaagaccggcgtctggcgacgcaaggcaatttcaacaacgaggtgggt
ctgccgctcactttgctgcgcttgcggccgcaacatcaggccgccgtggtcgaactcggg
atgaaccatccgggcgagatcgcctggctcgccagtctggccgagcccaccgtggcgcta
gtgaacaacgcccagcgcgagcatcaggaattcatgcacagtgtcgaagcagtcgcgcac
gaaaacggctcggtgctcgcggcattgccgcagaccggggtggcggtgtttcccgcagac
gacgcccagaccgcgatctgggtggcgcaagccgccggtcggcgtgtgttgcgctttgcc
ctgcgtgaaggggctgaggcgggcgtggaggctgaagtcagcggccatgcgttttatcgg
cagggccagttgcggctgcaattgcataccccgacgggccatgctgaagtgggcctgcaa
ctgctggggcggcacaacgcgcgcaatgcgctggcggcgaccgcagcggccttggccgca
ggcgcgccgctggatgccatctgccgcggactcgaagcctttgctccggtggccgggcgt
ctggtgccgcggcgtctgcgttgcgccgacgatcgcacgctgctgctgatcgacgacagc
tacaacgccaatcccgactcggtgcgcgccgccatcgacgtgttggccgagctgcccggg
cgcagcctgctgctgctcggcgatatgggcgaagtcggtgacaacggcccggccttccat
gccgaagtggggacgtatgcggcccagcgcggcgtagcggcgctgtgggcctgcggcgcc
atgacggcgcaggcggtcgcggccgcacaggcggcgggcctggcggcagcaaagcatcag
cccgacttgatggacttcaccctggatgccgcggcgctgcgcgaattcgacaccgtgctg
gtcaaaggctcgcgctttatgcgcatggagcgcgcggtgcaggccatcgccgcgctggcg
gcgaatggcaacggcgcgtccacgcaggaggtgcaccatgctgcatag

DBGET integrated database retrieval system