KEGG   Thiomonas intermedia: Tint_0514Help
Entry
Tint_0514         CDS       T01227                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tin  Thiomonas intermedia
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tint_0514
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tint_0514
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Tint_0514
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tint_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
548614..549741
Genome map
AA seq 375 aa AA seqDB search
MQPSSSVVQSARRIIIKAGSSLVTNEGRGVDLEAVSRWAGQIAGLRAAGKDVILVSSGAI
AEGMRRLGWSQRPREMHQLQAAAAVGQMGLAQAYETAFRERGMVAAQVLLTHADLADRQR
YLNARTTLLTLLEQGVVPVINENDTVVTDEIKFGDNDTLGALVTNLVEGDVLIILTDQSG
LYSADPRKHADATLIAQADAEDATLQAMAGGAGTGIGTGGMATKVTAARRAARSGAHTVI
ASGREPDVLLRLARGEIVGTQLLAGHAKLAARKQWMADHLQLRGWVRVDEGAARRLRAQG
ASLLPVGVVEVQGDFDRGDVIAVRDASGAEVARGLSNYAASQARRIMRHPSADIEAILGF
SEEPELIHRDNMVFL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttccagctctgtcgtgcagtcggcgcggcgcatcatcatcaaggccggttcc
agtctggtcaccaatgaagggcgtggcgtcgatctcgaagccgtgtcccgttgggcgggg
cagatcgcgggtctgcgtgcggcagggaaggatgtgattctggtctccagcggtgccatc
gccgaagggatgcgtcgcttgggctggtcgcaacgtccgcgcgagatgcaccagttgcag
gcggctgcagccgtcggccagatgggcttggcgcaagcttacgaaacggccttccgggag
cgcggcatggtcgccgcgcaggtgttgttaacccatgccgatctggcggatcgccagcgc
tatctcaacgcccgcacgaccttgttgaccttgttggagcagggggtcgtgccggtcatc
aacgaaaacgacaccgtggtcaccgacgagatcaagtttggtgacaacgacaccttgggc
gcgctggtcaccaatctggtggaaggcgatgtgctgatcatcctcactgaccaatcgggc
ctgtacagcgcggacccgcgcaaacatgctgacgccacgctgatcgcccaagccgacgcc
gaggacgccacgctgcaggccatggccggcggtgctggaacgggaatcggcaccggcggc
atggcgaccaaggtcacggcagcgcggcgtgcggcgcgcagtggcgcgcataccgtgatt
gccagcggacgcgagcccgatgtgctgctccggttggcgcggggcgagatcgttggcact
cagctactggctggtcacgccaagctagccgcgcgcaaacagtggatggccgatcacctg
caactgcgcggctgggtcagggtggacgaaggcgcagcccggcgtttgcgcgcacaaggg
gccagcttgctgccggttggcgtggtggaggtacagggcgacttcgatcgaggtgacgtc
atcgccgtgcgtgatgcaagcggagcggaagtggcgcggggcctgagtaattacgcggct
tcacaggcccggcgcatcatgcgccacccgtctgccgacatcgaggccatactcggtttc
agcgaggagcccgaactgattcaccgggacaatatggttttcctgtag

DBGET integrated database retrieval system