KEGG   Thiomonas intermedia: Tint_0514Help
Entry
Tint_0514         CDS       T01227                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tin  Thiomonas intermedia
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tin01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tin00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
548614..549741
Genome map
AA seq 375 aa AA seqDB search
MQPSSSVVQSARRIIIKAGSSLVTNEGRGVDLEAVSRWAGQIAGLRAAGKDVILVSSGAI
AEGMRRLGWSQRPREMHQLQAAAAVGQMGLAQAYETAFRERGMVAAQVLLTHADLADRQR
YLNARTTLLTLLEQGVVPVINENDTVVTDEIKFGDNDTLGALVTNLVEGDVLIILTDQSG
LYSADPRKHADATLIAQADAEDATLQAMAGGAGTGIGTGGMATKVTAARRAARSGAHTVI
ASGREPDVLLRLARGEIVGTQLLAGHAKLAARKQWMADHLQLRGWVRVDEGAARRLRAQG
ASLLPVGVVEVQGDFDRGDVIAVRDASGAEVARGLSNYAASQARRIMRHPSADIEAILGF
SEEPELIHRDNMVFL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttccagctctgtcgtgcagtcggcgcggcgcatcatcatcaaggccggttcc
agtctggtcaccaatgaagggcgtggcgtcgatctcgaagccgtgtcccgttgggcgggg
cagatcgcgggtctgcgtgcggcagggaaggatgtgattctggtctccagcggtgccatc
gccgaagggatgcgtcgcttgggctggtcgcaacgtccgcgcgagatgcaccagttgcag
gcggctgcagccgtcggccagatgggcttggcgcaagcttacgaaacggccttccgggag
cgcggcatggtcgccgcgcaggtgttgttaacccatgccgatctggcggatcgccagcgc
tatctcaacgcccgcacgaccttgttgaccttgttggagcagggggtcgtgccggtcatc
aacgaaaacgacaccgtggtcaccgacgagatcaagtttggtgacaacgacaccttgggc
gcgctggtcaccaatctggtggaaggcgatgtgctgatcatcctcactgaccaatcgggc
ctgtacagcgcggacccgcgcaaacatgctgacgccacgctgatcgcccaagccgacgcc
gaggacgccacgctgcaggccatggccggcggtgctggaacgggaatcggcaccggcggc
atggcgaccaaggtcacggcagcgcggcgtgcggcgcgcagtggcgcgcataccgtgatt
gccagcggacgcgagcccgatgtgctgctccggttggcgcggggcgagatcgttggcact
cagctactggctggtcacgccaagctagccgcgcgcaaacagtggatggccgatcacctg
caactgcgcggctgggtcagggtggacgaaggcgcagcccggcgtttgcgcgcacaaggg
gccagcttgctgccggttggcgtggtggaggtacagggcgacttcgatcgaggtgacgtc
atcgccgtgcgtgatgcaagcggagcggaagtggcgcggggcctgagtaattacgcggct
tcacaggcccggcgcatcatgcgccacccgtctgccgacatcgaggccatactcggtttc
agcgaggagcccgaactgattcaccgggacaatatggttttcctgtag

DBGET integrated database retrieval system