KEGG   Thiomonas intermedia: Tint_0563Help
Entry
Tint_0563         CDS       T01227                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tin  Thiomonas intermedia
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tint_0563
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tint_0563
Exosome [BR:tin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tint_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
601271..602776
Genome map
AA seq 501 aa AA seqDB search
MPSLIAALDQGTSSSRTLIVDLQGRVLASAQREFTQHYPQPGWVEHDPLDIWATQSATLT
EALARAAAKLSDLAAIGITNQRETVVLWERATGRPLANAIVWQDRRTAGICAQLAADGHA
PLLQERTGLLPDAYFSATKLAWLLDHIPGARARADRGELAAGTIDSWLVWNLSGGATHLT
DVSNASRTLLCNLHTGDWDDELLALLRVPRAVLPAIVPNCGALAVARLGGLDIPITGMAG
DQQAALFGQACLQPGMAKNTYGTGCFALQHTGTQAVRSQQRLLTTIAWKLGADQPLHYAL
EGGVFVAGAAVQWLRDGLGLVHSAQEAQQLADSVPDSGGVLLVPAFTGLGAPHWDAQARG
LLIGITRGTTAAQVARATIDSLAYQSAELFAAMQADVAAQGGPPLTELRVDGGAAVNDTL
MQFQADLLGVPVVRPMQAESTALGAAYLAGLGAGLWPNAAALHALWQEQRRFTPQMSTDE
RKARMARWRRAVERARDWADD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccctcattgattgccgcgctcgatcagggtacgtccagctcgcgcaccctcatcgtc
gatctgcagggccgggtgctggccagcgcgcagcgcgagttcacccagcactacccgcaa
cccggttgggtggaacatgacccgctcgacatctgggccacgcaaagcgccaccctcacc
gaagccctggcccgcgccgcagcgaagctgagcgatctcgccgccatcggcatcaccaac
cagcgcgaaaccgtggtgctgtgggagcgtgccaccggcaggccgctggccaacgccatc
gtctggcaagaccggcgcactgcgggcatctgcgctcagctcgcggctgacggccacgcg
ccgctgctgcaagagcgcaccggcctgttgcccgacgcctatttctcggccaccaagctg
gcttggctgctcgaccacattcccggcgctcgcgcccgcgctgaccgtggcgagttggcc
gcaggcaccatcgacagctggctggtgtggaacctaagcggcggcgcgacccacctcacc
gatgtcagcaatgccagccgcaccctgctgtgcaatctccacaccggcgattgggacgac
gagttgctggcgctgctgcgcgtgccccgcgccgtgctgcccgccatcgtgcccaactgc
ggcgcgctggccgtggcgcgtctgggcggtctggacattcccatcaccggcatggccggc
gaccagcaggccgcgctgttcggccaggcctgtctgcagcccggcatggcgaaaaacacc
tacggcaccggttgcttcgcgctgcagcacaccggcacgcaggcggtgcgctcgcagcag
cgtctgctgaccaccatcgcctggaagctcggcgccgatcagcccttgcattacgccctg
gaaggcggcgtgttcgtcgccggggccgcggtgcaatggttgcgcgacggcctcggcttg
gtgcacagcgcgcaagaagcgcagcaactcgccgacagtgtgccagacagcggcggcgtg
ctgctcgtgcccgccttcaccggcctgggcgcgccgcactgggacgcacaggcgcgcggc
ctgctcatcggcatcacccgcggcaccacggcagcgcaggtcgcccgcgccaccatcgac
agcctggcttatcaaagcgccgagctgttcgccgccatgcaggccgacgtcgccgcgcag
ggcgggccgccgctgaccgaactacgggtggatggcggcgcggcggtgaacgacacgctg
atgcagtttcaggccgacctgctgggcgtgcccgtggtacgccccatgcaggccgagagc
acggcgcttggcgcggcctatctggccgggctgggcgcaggcctgtggccgaacgcggct
gcgctgcacgcgctatggcaggaacaacgccgattcaccccgcagatgagcaccgacgag
cgcaaggcgcgcatggctcgctggcgccgcgccgtggagcgcgcccgcgactgggccgac
gactga

DBGET integrated database retrieval system