KEGG   Thiomonas intermedia: Tint_0730Help
Entry
Tint_0730         CDS       T01227                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tin  Thiomonas intermedia
Pathway
tin00010  Glycolysis / Gluconeogenesis
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_0730
Enzymes [BR:tin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Tint_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADG30126
JGI: Tint_0730
UniProt: D5X6J9
Position
796637..797539
Genome map
AA seq 300 aa AA seqDB search
MHSLDSLSRFSIPGQLRFHAHPAGLIFAEIDHAAGVARLCLQGAHLTSFRPKSQPEPVVW
VSEAARYLPGKSIRGGVPVCWPWFGPHASESSFPAHGFARTVPWAVVDSGASQGATHLTL
QLQPSDATRAQWPHDTPVSLRIRVSEVLEMDLITHNGTAQPLPLSEALHTYFQVGDIAEV
QLLGLDGCSYLDKTEAFARMQQQGPVRFAAETDRVYVDTSAECVIVDPLLQRRIRIAKQG
SASTVVWTPWEQKAAAMGDFTAQGWRNMLCVESANAADNALTLQPGETHTLSVRYSAEAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcctcgactcgctcagccgtttttccatccccggtcaacttcggttccatgcc
catccagccgggctgattttcgctgaaatcgaccatgccgcaggcgtggccagactctgt
ctgcagggcgctcacctcaccagctttcgccccaagtcgcagccggagccggtggtgtgg
gtgtctgaggcggcgcgctatttgccgggcaagtccattcgtggcggcgtgccggtgtgc
tggccctggttcgggccgcacgccagcgagagcagttttccggcgcacggctttgcccgc
accgtgccctgggcggtggtggacagcggggcatcgcaaggcgcgacgcacctcacgctg
caactgcaaccttcagacgccacccgcgcgcaatggccgcatgacacgccggtttccctg
cgcatccgcgtgtcggaggtgttggagatggacctgatcacacacaacggcaccgcgcag
ccgctgccgctcagcgaggcgctgcacacttatttccaggtcggcgatattgccgaggtg
caattgctggggctcgatggctgcagctatctcgacaagaccgaggccttcgcccgcatg
cagcaacagggcccggtgcgcttcgccgccgaaaccgaccgggtgtatgtggacacatca
gcggaatgcgtcatcgtcgatccgctgctgcagcggcgcattcgcattgccaagcagggg
tcggcgtccaccgtggtctggacgccgtgggagcagaaagccgccgccatgggcgacttc
accgcgcagggctggcgcaacatgctgtgcgtggagtcggctaacgcggcagacaacgcg
ctcaccttgcagcccggcgaaacccacaccctgagcgtgcgctacagcgccgaagcgctg
tga

DBGET integrated database retrieval system