KEGG   Thiomonas intermedia: Tint_0736Help
Entry
Tint_0736         CDS       T01227                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tin  Thiomonas intermedia
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tint_0736
   01230 Biosynthesis of amino acids
    Tint_0736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_0736
  Energy metabolism
   00680 Methane metabolism
    Tint_0736
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tint_0736
Enzymes [BR:tin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Tint_0736
Exosome [BR:tin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Tint_0736
  Exosomal proteins of melanoma cells
   Tint_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(804325..805032)
Genome map
AA seq 235 aa AA seqDB search
MYKLVMLRHGESTWNQQNRFTGWTDVDLTEQGIREARAAGRLLKELGYSFDLTYTSVLKR
AVRTLWLSLDELDAMWLPVVHTWRLNERHYGALQGLNKAETAAKYGDEQVHIWRRSYDTP
PPPLDETHRLELAADPRYARLKPEELPLTECLKDTIARVLPFWHESLAPAIKAGKRTLVV
SHGNSMRAIMKYLENISDEDITGLNIPNGIPLVYELDADLKPLQRYYLNAAGGKV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgtcatgctgcgccacggtgaatccacctggaatcagcaaaaccgcttt
accggctggaccgatgtcgatctgaccgagcagggcatccgcgaagcccgcgccgccggg
cgtctgctcaaggaactgggttacagcttcgacctgacctatacctcggtgctcaagcgc
gccgtgcgcaccctgtggctatcgctcgacgagctcgacgccatgtggctgcccgtggtg
cacacttggcggctcaacgagcgccactacggcgcgctgcaaggtttgaacaaggcggaa
accgccgccaagtacggcgacgaacaggtgcacatctggcgccgcagctacgacactcca
cccccgccgctcgacgaaacccaccgtctggaactggccgccgatccgcgctatgcccgc
ctcaaacccgaagagctgccgctgaccgagtgcctgaaagacaccatcgcgcgggttctg
ccgttctggcacgagtcgctggctccggccatcaaggcgggcaagcgcacgctggtggtg
tcgcacggcaactccatgcgcgccatcatgaagtacctggaaaacatctcggacgaagac
atcaccgggctgaacatccccaacggcattccgctggtgtacgagctcgacgccgatctc
aagccgctgcagcgctattacctcaacgctgcgggcggcaaggtctga

DBGET integrated database retrieval system