KEGG   Thiomonas intermedia: Tint_0802Help
Entry
Tint_0802         CDS       T01227                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tin  Thiomonas intermedia
Pathway
tin00020  Citrate cycle (TCA cycle)
tin00640  Propanoate metabolism
tin00660  C5-Branched dibasic acid metabolism
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
tin01200  Carbon metabolism
Module
tin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tint_0802
   00640 Propanoate metabolism
    Tint_0802
   00660 C5-Branched dibasic acid metabolism
    Tint_0802
Enzymes [BR:tin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tint_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADG30197
JGI: Tint_0802
UniProt: D5WY89
Position
864538..865743
Genome map
AA seq 401 aa AA seqDB search
MKIHEYQAKQLLREHGVPVPRGKPAFSVDEAIAAAQELGGPVWVVKAQIHAGGRGKGGGV
KLARTLDEVRQLSLQILGMQLVTHQTGPAGQKVRRLLIEEGADILKEYYVAVLTDRATQK
VAVMASSEGGMDIEEVAAKTPEKILKVFVDPLVGLQEAQGLELAAGIGIPLASQAQAIDV
FKKLYQCYMDTDASLVEINPLILEGNGGIKALDAKFNIDDNALFRHPEIEAMRDLDEEDP
AEVQAHKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGSPANFLDVGGGATTEKVTE
AFKIMLHNPHVKAILVNIFGGIMRCDTIAEGVIAASRTVGLSVPLVVRMKGTNEEIGRKM
LADSGLPIISANTMGRGGASRRSCRAGLSLPPQNKRTTWLS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaatatcaggccaagcaactattgagagaacacggtgtgccggtacca
cgcggcaagcccgcgttttccgtcgatgaggccatcgccgcagcgcaggagttgggcggc
ccggtctgggtggtgaaagcgcagattcacgccggcgggcggggcaagggcggtggcgtc
aagctggcgcgaacgctggacgaagtgcggcaactatccctgcaaatcctgggcatgcag
ctcgtcacccatcaaactgggcctgcggggcagaaagtgcgacggctgctgatcgaggag
ggcgccgatatcctaaaagagtattacgtcgccgtgctcaccgaccgtgccacgcaaaaa
gtggccgtcatggcgtcgagcgaaggcggcatggacatcgaagaggtggccgccaagacg
ccggagaaaatcctcaaggtgttcgtcgatccgctggttggcctgcaagaggcacagggg
ctggaactggccgcgggcatcggcattccgctcgcctcgcaggcccaggcgatcgacgtg
ttcaagaagctctaccagtgctatatggacaccgacgcctcgctggtggaaatcaacccg
ctgattctggaaggaaacggtgggataaaagcgctcgatgccaagttcaacatcgacgac
aacgccctgttccgtcaccccgaaatcgaggcgatgcgcgatctcgatgaggaagacccg
gccgaggtgcaggcgcacaaattcgatctcgcctacatccagcttgacggcaatatcggc
tgcctggtcaacggcgccgggctggcgatggcgacgatggacaccatcaagctattcggc
ggctcgcccgccaactttctcgatgtgggcggcggcgccaccaccgaaaaggtgaccgag
gcgttcaagatcatgctgcacaacccgcatgtcaaggcgattctggtcaacatcttcggc
ggcatcatgcgctgcgacaccatcgccgagggcgtgattgccgcctcgcgcaccgtgggc
ctgagcgtgcccctggtggtgcgcatgaagggcaccaacgaagagatcgggcgcaagatg
ctggccgactccggcctgcccatcatcagcgccaacaccatggggcgaggcggcgcaagc
cgccgttcatgccgcgcaggcctgagcctgcccccacagaacaagaggacaacatggcta
tcctga

DBGET integrated database retrieval system