KEGG   Thiomonas intermedia: Tint_0802Help
Entry
Tint_0802         CDS       T01227                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tin  Thiomonas intermedia
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tint_0802
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tint_0802
   00640 Propanoate metabolism
    Tint_0802
   00660 C5-Branched dibasic acid metabolism
    Tint_0802
Enzymes [BR:tin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tint_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
864538..865743
Genome map
AA seq 401 aa AA seqDB search
MKIHEYQAKQLLREHGVPVPRGKPAFSVDEAIAAAQELGGPVWVVKAQIHAGGRGKGGGV
KLARTLDEVRQLSLQILGMQLVTHQTGPAGQKVRRLLIEEGADILKEYYVAVLTDRATQK
VAVMASSEGGMDIEEVAAKTPEKILKVFVDPLVGLQEAQGLELAAGIGIPLASQAQAIDV
FKKLYQCYMDTDASLVEINPLILEGNGGIKALDAKFNIDDNALFRHPEIEAMRDLDEEDP
AEVQAHKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGSPANFLDVGGGATTEKVTE
AFKIMLHNPHVKAILVNIFGGIMRCDTIAEGVIAASRTVGLSVPLVVRMKGTNEEIGRKM
LADSGLPIISANTMGRGGASRRSCRAGLSLPPQNKRTTWLS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaatatcaggccaagcaactattgagagaacacggtgtgccggtacca
cgcggcaagcccgcgttttccgtcgatgaggccatcgccgcagcgcaggagttgggcggc
ccggtctgggtggtgaaagcgcagattcacgccggcgggcggggcaagggcggtggcgtc
aagctggcgcgaacgctggacgaagtgcggcaactatccctgcaaatcctgggcatgcag
ctcgtcacccatcaaactgggcctgcggggcagaaagtgcgacggctgctgatcgaggag
ggcgccgatatcctaaaagagtattacgtcgccgtgctcaccgaccgtgccacgcaaaaa
gtggccgtcatggcgtcgagcgaaggcggcatggacatcgaagaggtggccgccaagacg
ccggagaaaatcctcaaggtgttcgtcgatccgctggttggcctgcaagaggcacagggg
ctggaactggccgcgggcatcggcattccgctcgcctcgcaggcccaggcgatcgacgtg
ttcaagaagctctaccagtgctatatggacaccgacgcctcgctggtggaaatcaacccg
ctgattctggaaggaaacggtgggataaaagcgctcgatgccaagttcaacatcgacgac
aacgccctgttccgtcaccccgaaatcgaggcgatgcgcgatctcgatgaggaagacccg
gccgaggtgcaggcgcacaaattcgatctcgcctacatccagcttgacggcaatatcggc
tgcctggtcaacggcgccgggctggcgatggcgacgatggacaccatcaagctattcggc
ggctcgcccgccaactttctcgatgtgggcggcggcgccaccaccgaaaaggtgaccgag
gcgttcaagatcatgctgcacaacccgcatgtcaaggcgattctggtcaacatcttcggc
ggcatcatgcgctgcgacaccatcgccgagggcgtgattgccgcctcgcgcaccgtgggc
ctgagcgtgcccctggtggtgcgcatgaagggcaccaacgaagagatcgggcgcaagatg
ctggccgactccggcctgcccatcatcagcgccaacaccatggggcgaggcggcgcaagc
cgccgttcatgccgcgcaggcctgagcctgcccccacagaacaagaggacaacatggcta
tcctga

DBGET integrated database retrieval system