KEGG   Thiomonas intermedia: Tint_0862Help
Entry
Tint_0862         CDS       T01227                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tin  Thiomonas intermedia
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tin01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tin00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
923627..924964
Genome map
AA seq 445 aa AA seqDB search
MNAPLNAPIHALQLRRLDATGPDFETQYRALFARMADENAEIDARAADILRDVQQRGDAA
VLDYTRRFDRLDAPDMAVLEISQAELHAALAAINAEQRSALEAAAIRVRRYHERQLQQVG
QSWEYRDEDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVQEIIMVVPTP
GGERNPLVLAAAAVAGVSRAFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRV
FGVCGIDMIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDSAYIDAVAEA
IHRLLPDMPRRDIITASLNGRGALIRVRDMAQACELANRIAPEHLEISAQNPHQYVPALK
HAGALFLGAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFIKRSSIIEVSAEGAQQL
GRIASVLAHGERLTAHARAAEMRLR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccgctcaatgctccgatccatgccctgcaactgcgcaggctagacgccacc
ggccccgacttcgagacgcaataccgcgccctgttcgcccgcatggccgatgaaaacgcc
gagatcgatgcccgcgcggccgacatcctgcgcgatgtgcaacagcgcggtgatgccgcc
gtgctcgactacacgcgccgattcgaccgcctggacgcgcccgacatggccgtgctcgag
atcagccaggccgagctgcacgcggcgcttgccgccatcaatgcggagcagcgcagcgcg
ctggaggcggccgccatccgggtgcgccgctaccacgagcgccagttgcaacaagtcggc
cagagctgggagtaccgcgacgaagacggcaccctgctcggccagaaggtcacgcctctc
gaccgcgtgggcatttacgtgcccggcggcaaggcggcctatccctcttcggtgctgatg
aatgccattccggcgcatgtggcgggtgtgcaagagatcatcatggttgtgcctacgccg
ggcggcgagcgcaatccgctggtgttggccgcagcggccgtggccggcgtgagccgcgcc
ttcgccatcggcggcgcgcaggcggtgggcgctctggcttacggcacggccaccgtgccc
gcggtggacaaaatcgtcggccctggcaacgcctatgtggctgcggccaagcggcgggtg
ttcggcgtttgcggcatcgacatgatcgccgggccgtccgagattctggtgctcgccgac
ggcagcacgccgcccgactgggtggcgatggatctgttcagccaggccgagcatgacgaa
ctggcgcagagcatcctgctctgtccggactcggcctatatcgacgctgtggccgaggcc
atccaccggctgctgcccgacatgccgcgcagagacatcatcaccgcctcgctgaacggc
cgcggcgcgctcatccgcgtgcgcgacatggcgcaggcctgtgagctggccaaccgcatc
gcgccagagcatctggagatttccgcgcagaatccgcatcaatatgtgcccgcgctcaag
cacgctggcgcgctgtttctcggcgcctacacctccgagtcgctcggcgactactgcgcc
gggcccaaccatgtcttgcccacttcgggcacggcccggttctcctcgccgctgggggtg
tacgacttcatcaagcgttccagcatcatcgaggtcagcgccgagggcgcgcagcaactc
ggccgtatcgccagcgtgctggcccacggcgagcgcctgaccgcgcacgcccgcgccgcc
gaaatgcggctgcgctga

DBGET integrated database retrieval system