KEGG   Thiomonas intermedia: Tint_0945Help
Entry
Tint_0945         CDS       T01227                                 

Definition
(GenBank) Phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tin  Thiomonas intermedia
Pathway
tin00010  Glycolysis / Gluconeogenesis
tin00030  Pentose phosphate pathway
tin00051  Fructose and mannose metabolism
tin00052  Galactose metabolism
tin00230  Purine metabolism
tin00500  Starch and sucrose metabolism
tin00520  Amino sugar and nucleotide sugar metabolism
tin00521  Streptomycin biosynthesis
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_0945
   00030 Pentose phosphate pathway
    Tint_0945
   00051 Fructose and mannose metabolism
    Tint_0945
   00052 Galactose metabolism
    Tint_0945
   00500 Starch and sucrose metabolism
    Tint_0945
   00520 Amino sugar and nucleotide sugar metabolism
    Tint_0945
  Nucleotide metabolism
   00230 Purine metabolism
    Tint_0945
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tint_0945
Enzymes [BR:tin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tint_0945
    5.4.2.8  phosphomannomutase
     Tint_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADG30339
JGI: Tint_0945
UniProt: D5WZ01
Position
1010597..1011973
Genome map
AA seq 458 aa AA seqDB search
MAQLDPTIFKAYDIRGIVGKTLTEDACRAIGQAFATLARRNGETAVNISRDGRLSGPALA
QALSEGLRAGGVDVIDLGMNATPMLYYACATTPVVSGIQITGSHNPPEYNGLKMVLGGNA
LFGEQIQELLELTRSEAFAQGQGSARQASIVEDYLGRIEGDIKLARPMKVVVDCGNGVSG
AFAPRLLRSLGCEVVELFCEVDGTFPNHHPDPADPHNLEDLIRTVRDTGAELGLAFDGDG
DRLGVVTPSGAVIWPDRQLMLYAADVLERHPGAPILFDVKCTAQLPAWVRRHGGEPVMGR
TGHSLVKAKMKEIDAPLAGEMSGHIFFKDRWYGFDDAQYGAARLLEILSRAENAGAVLEA
LPDSVSTPELKLETAEGANFTLCDRLQREGRFPGASNISTIDGVRADYADGFGLARPSNT
TPCVVLRFEGVDAAALARVQAEFRAALLALDTSLKLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctcgatcccacgattttcaaggcctacgacattcgcggcatcgttggcaaa
acgctgaccgaagacgcctgccgcgcgatcggccaggccttcgccacactggcgcgccgc
aatggcgagacggcggtgaatatcagccgcgacgggcgtctgtccggcccggcgctggcg
caggcgctcagcgaaggcttgcgcgccgggggcgtggacgtgatcgatctgggcatgaac
gccacccccatgctgtactacgcctgcgccaccacgccggtggtcagcggcattcagatc
actggcagccacaatccgcccgagtacaacggcctgaaaatggtgctcggcggcaatgcc
ctgtttggcgagcagattcaggaattgctcgagctgacccgcagcgaagccttcgcacaa
ggacagggcagcgcgcggcaagcctctatcgtagaggactatctgggccgcatcgaaggc
gacatcaaactggcgcggccgatgaaagtggtggtcgattgcggcaacggtgtttcaggc
gcttttgcgccgcgcttgctgcgcagcctgggctgcgaagtggtggagttgttctgcgaa
gtcgatggcacctttcccaaccatcatcccgatcccgccgatccgcacaacctcgaagat
ctcatccgcaccgtgcgcgacaccggcgccgagctgggcctggcgttcgatggcgacggc
gaccgtctcggcgtggtcacgcccagtggggccgtcatctggcccgatcgccagctcatg
ctctacgccgccgatgtgctggagcgccatcccggcgcgcccattctgttcgacgtgaaa
tgcacagcgcagctgcccgcctgggtgcgtcggcatggcggcgagccggtgatgggacgc
accgggcattcgctggtcaaggccaagatgaaggaaatcgacgcgccgctggctggcgag
atgagcggccacatctttttcaaggatcgctggtacggcttcgacgacgcgcagtatggc
gcggcccggctgctggaaattctttctcgtgccgagaatgcgggcgccgtgcttgaagct
ctgcccgattccgtttctaccccggagctgaagctggagaccgcagagggcgccaacttt
acgctgtgcgaccgtttgcagcgcgaaggccgctttcccggcgcttcgaatatttccacc
atcgacggcgtgcgcgccgactatgccgatggcttcggcctggcgcggccctccaacacg
acgccctgcgtggtactgcgattcgagggcgtcgatgcagcggcgctggcgcgggtgcag
gccgagttccgcgctgcgctgttggcgcttgatacttcgttgaagctgccattttga

DBGET integrated database retrieval system