KEGG   Thiomonas intermedia: Tint_0950Help
Entry
Tint_0950         CDS       T01227                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tin  Thiomonas intermedia
Brite
Enzymes [BR:tin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tint_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_11 MTS PrmA Methyltransf_12 Methyltransf_18 Methyltransf_23 Methyltr_RsmB-F MetW GCD14 Ubie_methyltran Cons_hypoth95 Methyltransf_4 Methyltransf_32 UPF0020 CMAS DUF938
Motif
Other DBs
NCBI-ProteinID: ADG30344
JGI: Tint_0950
UniProt: D5WZ06
Position
complement(1014850..1015500)
Genome map
AA seq 216 aa AA seqDB search
MSIEQARFNMIEQQIRPWNVLDAGILELLGSVRREDFVPAAYRGLAFMDTEIPLPCGQNM
LAPKVEARILQELAVRKDEWVLEIGAGSGFMAALLGHRAAAVQTLEIHEELVTMARANLQ
RAGMNNVTVEQADGAHYAKSAEFDVIVLSGSVARIPQDLLQRLKPGGRLAAIVGDEPVMR
AQIVTRATATDFRTRDLFDTVATRLEHFPEPSRFQF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgagcaagcccgtttcaacatgatcgagcagcagatccgtccctggaatgtg
ctggacgccggcatcctcgaactactgggcagcgtgcgccgcgaagacttcgtgcccgcg
gcctatcgcggtctggccttcatggacaccgaaattcccctgccctgcggccagaacatg
ctcgcccccaaggtagaggcgcgcatcctgcaagaactcgcggtgcgcaaggatgaatgg
gtgctcgaaatcggcgcgggcagcggcttcatggccgccctgctcggccaccgcgccgct
gcggtgcagacactggaaattcatgaagaactggtgaccatggcgcgcgccaacctgcag
cgcgccggcatgaacaacgtcaccgtcgagcaggccgatggcgcgcactacgccaaaagc
gccgaattcgatgtgatcgtgctctccggctcggtcgcgcgaattccgcaagacctgctg
caacgcctcaaaccgggcgggcggctggcggccatcgtcggcgacgaacccgtgatgcgc
gcgcagatcgtcacccgcgccaccgccaccgacttccgcacccgcgatctgttcgatacc
gtggccacgcggctggagcatttccccgagccctcgcgcttccaattctga

DBGET integrated database retrieval system