KEGG   Thiomonas intermedia: Tint_0968Help
Entry
Tint_0968         CDS       T01227                                 

Definition
phosphodiesterase I
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tin  Thiomonas intermedia
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tin00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tin00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tin02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1033328..1034740)
Genome map
AA seq 470 aa AA seqDB search
MGAAPKTALIPPTRRAFLRGGLVTSALLATGQWPFPAAWAEPAAPGVLYAGPMQGYVAAR
SALIWVQTPGAAEVALEYAPENQPGEKKRSASVRTDPAGQFCAHLVMDDLSPGTRYRAVA
WVNGKPAANRTLVVRTQPIWQFRSPPPDVTLLTGSCAYLNDPLFDRPGQPYGGGYEIYEP
MTQEGADLMVWLGDNLYYREVDCQSPQGMALRYRQQRGFAPLDAFLRSTPQVAIWDDHDY
GPNDSDASFEFKNASLDLFKTYWANPTYGVGDVAGVFTKTSIADADIFLLDDRWWRSADA
TSPGDRGKVMFGPAQMRWLRNALLFSRARFKIVAAGGQFFNDDDAYEGWNQFPEERAAFL
GWLQQYRIPGLLFLSGDRHITELIRYPRPAYGGKRDYPLVEFTCSPLNSGPAKGDGNPNR
VPGTLVAERNYGVLKFSGEGKERRLELQAKNVGGKLLWSHTLALADLGWS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcggcgccgaaaaccgcgttgatccctccgacccgccgcgcattcttgcggggc
ggtctggtgacttccgcgctgctggccaccgggcaatggccctttcctgcagcctgggca
gaaccagccgcccccggcgtgctctacgccgggccgatgcagggctatgtggctgcacgc
tctgccctcatctgggtgcaaacgcccggcgcagccgaagtggcgttggagtatgcccca
gagaatcagcccggcgagaaaaagcgctccgcgtcggttcgcaccgatccggcagggcag
ttctgcgctcatctggtcatggacgatctctctcccggcacgcgctaccgtgctgtggcc
tgggtcaatggcaaaccggctgcgaatcgcaccctcgtcgtgcgcacgcagcccatctgg
cagtttcgttcaccgccgcccgatgtcaccctcctgacgggctcttgcgcgtatctgaac
gacccgctgttcgaccggccgggccagccctatggcggcggctacgaaatctatgagccg
atgacacaggaaggcgccgatctgatggtgtggctgggcgacaacctctattaccgcgag
gtggattgtcagagcccgcaaggcatggcgctgcgctaccgccaacagcgcggcttcgcc
ccgctggatgcgtttttacgctccaccccgcaagtggcgatctgggacgaccatgattac
ggcccgaacgacagcgatgcgagtttcgagttcaagaacgcctcgctcgatctgttcaaa
acctattgggccaacccgacgtatggcgttggcgacgtcgccggagtgttcaccaagacc
agcatcgccgatgccgatatttttctgctcgatgatcgttggtggcgcagcgcagacgcc
accagcccaggtgaccgcggcaaggtgatgttcggcccggcgcagatgcgctggctgcgc
aacgccttgttgttctcgcgcgcccgcttcaagatcgtcgccgccggcggccagtttttc
aacgacgacgacgcttacgagggctggaaccagtttcccgaagaacgcgccgcatttctc
ggctggctgcagcaataccgcatccccggcttgctgtttctctcgggagaccggcacatc
accgagctgatccggtatccgcgtccggcctacggcggcaagcgcgactatccgctggtg
gagttcacctgctcgccgctgaattccgggccggccaaaggcgacggcaatcccaaccgc
gtacccggcacgctagtcgctgagcgcaactacggcgtgctcaaattcagcggcgagggc
aaggagcggcggctggaactgcaagccaagaacgtcggcggcaagctgctgtggtcgcac
accctggcgctggccgacctgggctggagctag

DBGET integrated database retrieval system