KEGG   Thiomonas intermedia: Tint_1098Help
Entry
Tint_1098         CDS       T01227                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tin  Thiomonas intermedia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tint_1098
Enzymes [BR:tin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tint_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1177509..1179068)
Genome map
AA seq 519 aa AA seqDB search
MGALIPSALILSPCLMTPTPRFPRSSGVLLHLTSLPSPHGSGDLGPAAYHFIDWLHAAGQ
SVWQFLPLGGIGLGGSPYMSSSAFAGNVLLIDLTELHRRGWLEADDLVAQEGLSNERVQF
DRVIPYRMERLRRAAARFETTATPQERADLAAFQAAQAVWLDDYALFMALSEHYGERLWN
TWDAALAQRQPEALQQARAQHAERIAFWTFAQWCFFRQWAALRAYAHDKGVRLMGDMPIF
ISLNSADVWARPDLFQLDARGHPTVVAGVPPDYFSATGQRWGNPHYRWAAHEAEGFAWWI
ARLRATFELVDWVRVDHFRGFESCWEIPADEPTAIGGRWVQAPGVALFEAVSKALGPLPI
IAEDLGVITPEVTALRQRFGFPGMRILHFAWGQNDGGDNAYLPHNYTHDTVVYPGTHDND
TSEGWWATAPEAVRHHLREYLACDGGDIAWTLIRAASASVADIALFALQDVLRLDGTQRM
NTPGTAQGNWTWRFTWDQVQPGHAAGLLRFGQLYNRLPA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccctgattccgtctgccttgattctgtccccctgcctcatgacgcccaccccc
cggtttccccgctccagcggcgtgctgctgcacctcaccagtctgcccagcccgcacggc
agcggcgatctcgggcccgcggcctaccacttcatcgactggctgcatgccgccggacag
tcggtctggcaattcctgccgctgggcggcatcggtctgggcggctcgccctatatgagc
agttcggctttcgccggcaatgtgctgctgatcgacctcaccgagttgcaccggcgcggc
tggctggaagccgacgatctcgtcgcgcaagagggactgtcgaacgagcgcgtgcagttc
gaccgcgtcatcccgtatcgcatggaacgtctgcgccgggccgcagcacggttcgagacg
accgccacgccgcaggagcgcgccgatctggccgccttccaggccgcgcaagccgtctgg
ctcgacgactacgcgttgttcatggcgctgtccgagcactacggcgagcgcttgtggaac
acctgggacgccgcgctggcgcagcgccagcccgaagcgctgcagcaagcgcgggcccag
cacgccgagcgcatcgccttctggaccttcgcccaatggtgctttttccgccagtgggcc
gctctgcgcgcctatgcccacgacaaaggcgtgcggctgatgggcgacatgccgattttc
atttcgctcaacagcgccgatgtttgggcccggcccgacctgttccagctcgacgcccgc
ggccatcccaccgtcgtcgccggggtgccgcccgactatttttccgccaccggacagcgc
tggggcaacccgcattaccgctgggcggcgcacgaggctgaagggtttgcctggtggatc
gcacggctgcgcgccaccttcgagctggtggactgggtgcgcgtcgatcatttccgcggt
ttcgagagctgctgggaaatccccgccgacgagcccacggccatcggcggccgctgggtg
caggcgccgggcgtggcgctgttcgaggcggtgtccaaagcgctcggcccgctgcccatc
attgccgaagatctgggcgtcatcacccccgaagtcaccgccctgcgccagcgcttcggc
tttcccggcatgcgcatcctgcacttcgcctgggggcagaacgatggcggcgacaacgcc
tacctgccgcacaactacacccacgacaccgtggtctatcccggcacccacgacaacgac
acctctgagggctggtgggcgacagcgcccgaggccgtgcgccaccatctgcgcgaatac
ctcgcctgcgacggcggcgacatcgcctggacgctgatccgcgccgccagcgccagcgtg
gccgacatcgccctgttcgccttgcaggacgtgctgcgtctggatggcacgcagcgcatg
aacacgccgggcacggcgcaaggcaactggacctggcgcttcacctgggatcaggtacaa
ccggggcatgcggctggcctgctgcgtttcggccagctctacaaccgccttcccgcctga

DBGET integrated database retrieval system