KEGG   Thiomonas intermedia: Tint_1166Help
Entry
Tint_1166         CDS       T01227                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tin  Thiomonas intermedia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1239617..1241257
Genome map
AA seq 546 aa AA seqDB search
MPTISDQARATLKRLLELKLQPTPDNYRRVFESLQNGAALPSAEPSLESPDWGRALPRLL
EQWERSQSGLTQLQKRQQLDRLVALPTPQAQWRELEQLLERWSALPARSGSQSASTPIET
RDDAAHRAGSEWRELWLQTLKFGVRPFCAYDTAQRLLRELMAAAETSKQAADLGTQAREV
WLAIDREQTTEEAVRNGLIELARLLLDHLGDLVPQAWVGVQATAIREQLQTPLAPERIES
AQNAVRDLLVRHSVLRKSEDDAHHTAKALIDLLVRKLGDYAAEGGEYNQRMEARLEQLQS
SREWDEIRDLVQDVLDDSRNMQQRSGELGVHLAEAQRQAQAAQERIRSLEGELEQVSQQL
QEDPLTGALNRRGLDAEFTRMQSRVVRQGQPLTLALLDLDHFKAVNDTHGHDTGDAVLKA
LVAQAKRLIRPSDRVARMGGEEFMLLLPDTPVQQSLVVVQRLLVAFSDQTLVQDSTGRRI
PLSFSAGVAELCPDEDFPAIYQRVDAALLQAKQAGRKRVEFAVPCDGAKAGGSLPKSALR
FFALRG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatttccgaccaggcgcgcgccaccctcaagcgcttgctcgaactcaagctg
cagcctaccccggacaactaccgccgcgtttttgaaagtctgcaaaatggcgcagcgctt
ccgtccgcagagccttcgctggaaagcccggattggggccgtgcgctgccccggctgctg
gagcaatgggagcgctcgcaaagcgggctgacccagttgcaaaaacgccagcaactcgac
cgcctcgtcgccttgcctacgccgcaggcccagtggcgcgagttggagcaactgctggag
cgctggagtgcactgcccgcgcgcagcggcagtcagagcgcgtccacacccattgaaacc
cgcgacgacgctgcgcaccgtgcaggcagcgaatggcgcgagctttggctgcaaaccctc
aaatttggcgtgcgccccttttgcgcgtacgacaccgcgcagcgcctgctgcgcgagttg
atggcggcggcagaaacctccaaacaggcggccgacctgggcacgcaggcgcgcgaagtc
tggttggccatcgaccgcgagcaaaccaccgaagaggcggtgcgcaacggcttgattgaa
ctcgcgcggctgttgctcgatcatctcggcgatctggtgccgcaggcctgggtaggcgtg
caggccacggcgattcgcgagcaattgcagacgccgctcgcccccgagcgcatcgaatcg
gcgcagaatgccgtgcgcgatctactggtgcgccacagcgtgctgcgcaagagcgaagac
gacgcgcaccacaccgccaaggcgctgatcgatctgttggtgcgcaagctgggcgactac
gccgccgagggcggcgaatacaaccagcgcatggaagcccggctggagcaattgcagagc
agccgcgaatgggacgaaatccgcgatctggtgcaggatgtgctcgacgacagccgcaat
atgcagcagcgcagcggcgaactcggcgtgcatctggccgaggcgcagcgccaggcgcag
gcggcgcaagagcgcatccgctcgctcgaaggcgaactggaacaggtcagccagcaattg
caggaagacccgctcaccggcgcgctcaaccgccgcgggctggatgccgagttcacccgt
atgcagtcgcgcgtggtgcgtcagggccagcctctcaccctggcgctgctcgacctcgat
cacttcaaggcggtgaacgacacccacggccacgatactggcgacgccgtgctcaaggcg
ctggtggcgcaggccaaacggctgatccggcccagcgaccgcgtggcgcgcatggggggc
gaggagttcatgctcctcctgcccgacacgccggtgcagcagtcgctcgtcgtggtgcag
cggctgctggttgcgttcagcgatcagaccctggtgcaggacagcacggggcggcgcatt
cccctgagtttcagcgccggggtggccgagctgtgtccggatgaagactttcccgcgatc
tatcagcgcgtggacgccgcactgctgcaggccaagcaggcggggcgcaaacgggtggaa
ttcgccgtgccctgcgatggcgccaaggccggcggcagcctgcccaagagcgcgctgcga
ttcttcgcgcttcggggataa

DBGET integrated database retrieval system