KEGG   Thiomonas intermedia: Tint_1166Help
Entry
Tint_1166         CDS       T01227                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
tin  Thiomonas intermedia
Brite
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Tint_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1239617..1241257
Genome map
AA seq 546 aa AA seqDB search
MPTISDQARATLKRLLELKLQPTPDNYRRVFESLQNGAALPSAEPSLESPDWGRALPRLL
EQWERSQSGLTQLQKRQQLDRLVALPTPQAQWRELEQLLERWSALPARSGSQSASTPIET
RDDAAHRAGSEWRELWLQTLKFGVRPFCAYDTAQRLLRELMAAAETSKQAADLGTQAREV
WLAIDREQTTEEAVRNGLIELARLLLDHLGDLVPQAWVGVQATAIREQLQTPLAPERIES
AQNAVRDLLVRHSVLRKSEDDAHHTAKALIDLLVRKLGDYAAEGGEYNQRMEARLEQLQS
SREWDEIRDLVQDVLDDSRNMQQRSGELGVHLAEAQRQAQAAQERIRSLEGELEQVSQQL
QEDPLTGALNRRGLDAEFTRMQSRVVRQGQPLTLALLDLDHFKAVNDTHGHDTGDAVLKA
LVAQAKRLIRPSDRVARMGGEEFMLLLPDTPVQQSLVVVQRLLVAFSDQTLVQDSTGRRI
PLSFSAGVAELCPDEDFPAIYQRVDAALLQAKQAGRKRVEFAVPCDGAKAGGSLPKSALR
FFALRG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatttccgaccaggcgcgcgccaccctcaagcgcttgctcgaactcaagctg
cagcctaccccggacaactaccgccgcgtttttgaaagtctgcaaaatggcgcagcgctt
ccgtccgcagagccttcgctggaaagcccggattggggccgtgcgctgccccggctgctg
gagcaatgggagcgctcgcaaagcgggctgacccagttgcaaaaacgccagcaactcgac
cgcctcgtcgccttgcctacgccgcaggcccagtggcgcgagttggagcaactgctggag
cgctggagtgcactgcccgcgcgcagcggcagtcagagcgcgtccacacccattgaaacc
cgcgacgacgctgcgcaccgtgcaggcagcgaatggcgcgagctttggctgcaaaccctc
aaatttggcgtgcgccccttttgcgcgtacgacaccgcgcagcgcctgctgcgcgagttg
atggcggcggcagaaacctccaaacaggcggccgacctgggcacgcaggcgcgcgaagtc
tggttggccatcgaccgcgagcaaaccaccgaagaggcggtgcgcaacggcttgattgaa
ctcgcgcggctgttgctcgatcatctcggcgatctggtgccgcaggcctgggtaggcgtg
caggccacggcgattcgcgagcaattgcagacgccgctcgcccccgagcgcatcgaatcg
gcgcagaatgccgtgcgcgatctactggtgcgccacagcgtgctgcgcaagagcgaagac
gacgcgcaccacaccgccaaggcgctgatcgatctgttggtgcgcaagctgggcgactac
gccgccgagggcggcgaatacaaccagcgcatggaagcccggctggagcaattgcagagc
agccgcgaatgggacgaaatccgcgatctggtgcaggatgtgctcgacgacagccgcaat
atgcagcagcgcagcggcgaactcggcgtgcatctggccgaggcgcagcgccaggcgcag
gcggcgcaagagcgcatccgctcgctcgaaggcgaactggaacaggtcagccagcaattg
caggaagacccgctcaccggcgcgctcaaccgccgcgggctggatgccgagttcacccgt
atgcagtcgcgcgtggtgcgtcagggccagcctctcaccctggcgctgctcgacctcgat
cacttcaaggcggtgaacgacacccacggccacgatactggcgacgccgtgctcaaggcg
ctggtggcgcaggccaaacggctgatccggcccagcgaccgcgtggcgcgcatggggggc
gaggagttcatgctcctcctgcccgacacgccggtgcagcagtcgctcgtcgtggtgcag
cggctgctggttgcgttcagcgatcagaccctggtgcaggacagcacggggcggcgcatt
cccctgagtttcagcgccggggtggccgagctgtgtccggatgaagactttcccgcgatc
tatcagcgcgtggacgccgcactgctgcaggccaagcaggcggggcgcaaacgggtggaa
ttcgccgtgccctgcgatggcgccaaggccggcggcagcctgcccaagagcgcgctgcga
ttcttcgcgcttcggggataa

DBGET integrated database retrieval system