KEGG   Thiomonas intermedia: Tint_1345Help
Entry
Tint_1345         CDS       T01227                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tin  Thiomonas intermedia
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tint_1345
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tint_1345
  Amino acid metabolism
   00310 Lysine degradation
    Tint_1345
Enzymes [BR:tin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tint_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1444076..1445374
Genome map
AA seq 432 aa AA seqDB search
MALIDIKVPQLSESVAEATLLTWKKKPGEPVAQDEILIEIETDKVVLEVPAPEAGVMAQI
LKNDGESVTSDEVIAKIDTEAKPQTSPLPVAPVKAAEPTASAPAAVATAAPSAGAAVAMP
AAAKIMAEQGVNPSDVAGTGRGGRITKGDALQAAAAPKPPTVPAPTPAPKPATAAAAMPS
LTIPALQPVEADLDLAAYTDRPEQRVPMSRLRARIAERLLQSQATNAILTTFNEVNMKPV
IDMRNLYKDKFEKQHGVKLGFMSFFVRAAVHALRKFPLLNASIDGNDIVYHGYFDIGIAV
GSPRGLVVPILRNADQMSFADIEKAIADFGAKARDGKLTIEELTGGTFSISNGGVFGSML
STPIINPPQSAILGIHATKDRPVVEDGQIVIRPMNYLALSYDHRLIDGREAVLSLVAMKE
ALEDPARLLLDL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatcgacatcaaagttccccaactctccgaatccgtggctgaagccactctg
ctgacctggaagaaaaagcccggcgaacccgtggcgcaggatgaaatcctgattgaaatc
gagaccgacaaagtggtgctcgaagtgcccgcacccgaagccggggtgatggcgcagatc
ctcaagaacgacggcgaatcggtgaccagcgacgaagtcatcgccaagatcgacactgaa
gccaagccgcagaccagcccgttgcccgtggcaccggtcaaggcggctgaaccgactgct
tcggctccggctgcagttgcgactgcggccccctccgcaggcgcggcggtggccatgccg
gctgcggcgaagatcatggccgagcagggcgtgaatccgtcagacgtggcgggcaccggg
cgcggcggccgcattaccaagggcgatgccttgcaggctgcggctgcgcccaagccgccg
accgttccagccccaacgcccgcgccgaaaccggcgaccgctgcggccgcaatgccctcg
ctcaccatccccgcgttgcagccggtggaggccgatctcgatctcgccgcctacaccgac
cggcccgaacagcgcgtgccgatgagccgcctgcgcgcgcgcatcgccgagcggctgctg
cagtcgcaggcgaccaatgccatcctcaccaccttcaacgaagtgaacatgaagccggtg
atcgacatgcgcaatctgtacaaagacaagttcgagaagcagcacggcgtgaagctgggt
ttcatgagcttttttgtgcgtgccgcagtgcatgcgctgcgcaagttcccgctgctcaac
gcctcgatcgatggcaatgacatcgtctatcacggctacttcgacatcggcatcgccgtg
ggcagtccgcgcgggctagtggtgcccattctgcgcaatgccgatcagatgagttttgcc
gacatcgaaaaagccatcgccgattttggcgccaaggcgcgtgacggcaagctgaccatc
gaggagctcaccggcggcaccttctccatcagcaacggcggggtgttcggctcgatgctg
tccacgcccatcatcaacccgccgcagtcggccattctgggcatccacgccaccaaagac
cggcccgtggtcgaagacggtcagatcgtgattcgcccgatgaactacctggcgctgagc
tacgaccaccgcctgatcgacggccgcgaagcggtgctgagtctggtggcgatgaaagag
gcgctcgaagacccggcgcgtctgctgctcgatctttga

DBGET integrated database retrieval system