KEGG   Thiomonas intermedia: Tint_1386Help
Entry
Tint_1386         CDS       T01227                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tin  Thiomonas intermedia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tin00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tin00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1489328..1489825)
Genome map
AA seq 165 aa AA seqDB search
MTQLVLIAAVARNGMIGKDGGMPWHLPADLQHFKRLTLGHPILMGRRTWDSLGRPLPGRR
NIVISRQPGWQAAGAEPAESLPAALQRISNDALAFVIGGAQLYAQALPLADRLELTEIDH
DFDGDTRFPNWDRSRFTETARESHLAPEGWAYHFVTYTATTASTD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactcagcttgtgctcatcgccgctgtggcgcgcaacggcatgatcggcaaagacggc
ggcatgccctggcatctcccggccgatctgcagcacttcaagcgcctcaccctgggccac
cccatcctgatggggcgccgtacctgggattcattgggacgaccgcttccgggacgccgc
aatatcgtgatcagccgtcagcccggatggcaggcggcgggggcggaacctgccgagtca
cttccggcggcactgcaacggatcagcaacgatgcactggccttcgtcatcggcggcgcc
cagctctatgcccaagcgctacccctggctgaccggctggaactcaccgagatcgaccac
gacttcgacggcgacacgcgctttcccaattgggaccgcagccgcttcaccgaaaccgcc
cgagagtcgcacctcgcgcctgaaggctgggcctatcacttcgtcacctacaccgcgacg
acggcatcgacagactga

DBGET integrated database retrieval system