KEGG   Thiomonas intermedia: Tint_1388Help
Entry
Tint_1388         CDS       T01227                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tin  Thiomonas intermedia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tint_1388
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tint_1388
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tint_1388
Enzymes [BR:tin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tint_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1490821..1492023
Genome map
AA seq 400 aa AA seqDB search
MQPAIDLQPDVNGNFGHYGGQYLPPHLKAVMDDIGSAYLSIRDSKAYRSELDDLYTHFVG
RPSPIYLAKRLTAHCGGARIWFKREDLNHTGAHKINHCLGEALLAKHMGKTKVLAETGAG
QHGVALATACALVGLPCEIHMGEIDVAKEHPNVTKMKILGARVVSVDRGTKTLKDAVDSA
FDEYLRDPEHFFYAIGSVVGPHPFPMMVAEFQSVVGREAREQFPKQAGKLPDVVAACVGG
GSNAMGIFSGFINDPGVRLVGVEPSGVGRETGKHAATLTYGKPGTLHGFRSYLLQEVKEG
EPDPVYSIASGLDYPGVGPQHAYLKDMGRAEYYAVDDAACLEAFMTLSRTEGLIPALESA
HAVAWAMKQAAALGKDADILVNLSGRGDKDADFVADKLGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagccatcgatctgcaaccggacgtcaacggcaacttcgggcactacggtggc
cagtacctgccgccgcatctcaaggccgtcatggacgacatcggcagcgcctatctgtcc
atccgcgacagcaaggcttaccgcagcgagctggatgatctctatacccactttgtcggc
cgccccagccccatctatctggccaaacgactgaccgcgcattgcggcggcgcgcgcatc
tggttcaagcgcgaagacctcaaccataccggcgcgcacaagatcaaccactgtctgggc
gaggcgctgctggccaaacacatgggcaagaccaaggtgctggcggaaaccggcgccggg
cagcatggcgtggcgctggccacggcctgcgcgctggtcgggctgccgtgcgaaatccac
atgggcgagatcgacgtcgccaaggaacaccccaatgtcaccaagatgaagattctcggc
gctagggtggtgagcgtcgatcgcggcaccaagacgctcaaagatgccgtggacagcgcc
ttcgacgaatatctgcgcgaccccgagcatttcttctacgccatcggctcggtggtcggt
ccgcaccccttcccgatgatggtggccgagttccagtcggtcgttggccgcgaggcgcgc
gagcaatttccgaagcaggcgggcaagctgcccgatgtggtcgctgcttgcgtgggcggc
gggtcgaacgcgatgggtattttttccggcttcatcaatgatccgggcgtgcgtctggtg
ggcgtggagccctcgggcgtcggtcgcgagaccggcaagcatgcggccacgctcacctac
ggcaagcccggcacgctgcacggctttcgttcctatctgctgcaggaagtgaaggaaggc
gagcccgacccggtgtattccatcgcctccggactcgactaccccggcgtggggccgcag
catgcctatctcaaggatatgggccgcgccgagtattacgccgtcgacgacgcggcctgc
ctggaggcgttcatgacgctgtcgcgcaccgaaggactcattccggcactcgaatcggcc
catgccgtcgcctgggcgatgaagcaggccgcagcactcggcaaagacgctgacattctg
gtcaacctctccggccgtggcgacaaggatgcggatttcgtcgcggataagctggggctg
taa

DBGET integrated database retrieval system