KEGG   Thiomonas intermedia: Tint_1594Help
Entry
Tint_1594         CDS       T01227                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tin  Thiomonas intermedia
Pathway
tin00071  Fatty acid degradation
tin00072  Synthesis and degradation of ketone bodies
tin00280  Valine, leucine and isoleucine degradation
tin00310  Lysine degradation
tin00362  Benzoate degradation
tin00380  Tryptophan metabolism
tin00620  Pyruvate metabolism
tin00630  Glyoxylate and dicarboxylate metabolism
tin00640  Propanoate metabolism
tin00650  Butanoate metabolism
tin00900  Terpenoid backbone biosynthesis
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
tin01200  Carbon metabolism
tin01212  Fatty acid metabolism
tin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tint_1594
   00630 Glyoxylate and dicarboxylate metabolism
    Tint_1594
   00640 Propanoate metabolism
    Tint_1594
   00650 Butanoate metabolism
    Tint_1594
  Lipid metabolism
   00071 Fatty acid degradation
    Tint_1594
   00072 Synthesis and degradation of ketone bodies
    Tint_1594
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tint_1594
   00310 Lysine degradation
    Tint_1594
   00380 Tryptophan metabolism
    Tint_1594
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tint_1594
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tint_1594
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tint_1594
Enzymes [BR:tin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tint_1594
Exosome [BR:tin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tint_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADG30968
JGI: Tint_1594
UniProt: D5X1H2
Position
complement(1707740..1708921)
Genome map
AA seq 393 aa AA seqDB search
MTEAVIVSTARTALAKSWRGSLNLTHSATMGGHVVQAAVQRAGIDAAEVEDCIIGCAYPE
GASGGNIARQIALRAGLPVTTAGATVNRFCSSGLQAIAIAAQRVIVDQVPVMVAGGVESI
SCVQNDRANTHMLREPWLLQHKPELYWSMLQTAECVAKRYGISRQLQDEYGARSQQRAAA
AQAAGKFLDEIVPITVRAGMADKATDQLVTREVTLSADEGIRADTTLEGISRIRPALPGG
VIAAGNASQFSDGASACVVMNAKLAEQRGLQPLGAFRGFAVAGCEPDEMGIGPVFAIPRL
LQRTGLKMNDIGLWELNEAFAVQVIYCRDKLGIPDERLNVNGGAIAVGHPYGVTGARLVG
HALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagccgtcattgtttccactgcgcgcacggcacttgccaagtcgtggcgtggg
tcgctcaatctcacgcacagcgccaccatgggcggccatgtcgttcaggcggccgtgcag
cgcgcaggcatcgatgctgccgaggtagaagactgcatcatcggttgcgcctatccggaa
ggcgcatcgggcggcaatatcgcgcggcagattgccctgcgcgccggccttccggtcacc
acggccggcgccaccgtcaaccgcttttgctcctccgggctgcaggccatcgcgattgca
gcgcagcgcgtcatcgtggatcaggtgccggtgatggtggccggtggcgtggagtcgatt
tcctgcgtgcagaacgatcgcgccaatacgcacatgctgcgcgaaccctggctgctgcag
cacaagcccgagctgtactggagcatgctgcaaacggcggaatgcgtggccaagcgatac
ggcatttcgcgccagttgcaggacgaatacggcgcccgcagccagcagcgcgcagcagcg
gcgcaggccgcaggcaagttcctcgatgaaatcgtgcccatcacggtacgcgccggtatg
gctgacaaggccactgaccagcttgtgacgcgggaagttacgctgagcgctgacgaaggc
attcgcgcagacaccaccctggagggcatatcccgaatccgtccggccctgccgggcggg
gtgattgccgctggtaacgccagccagttttccgacggcgcatcggcctgcgtggtgatg
aacgccaagttggccgagcagcgcggactccagcccttgggcgctttccgcgggtttgcc
gttgcgggttgcgagcccgacgaaatgggcatcggcccggtgttcgccattccgcgcctg
ctgcagcgcaccgggctgaagatgaacgacatcggcctgtgggaactcaacgaggccttc
gcggtgcaggtgatttattgccgcgacaagctcggcattcccgacgaaaggctgaacgtc
aacggcggcgccatcgcggtgggacatccatacggcgtaaccggcgcgcggctggtgggt
catgcgctgatcgagggcaagcgccgcggagcgaaatatgtggtcgtcaccatgtgcatc
ggtggcggtcagggcgctgcgggcttgttcgaggtgctctga

DBGET integrated database retrieval system