KEGG   Thiomonas intermedia: Tint_1724Help
Entry
Tint_1724         CDS       T01227                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tin  Thiomonas intermedia
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1851725..1852552)
Genome map
AA seq 275 aa AA seqDB search
MASHWKAGRFTLQLHRPLVMGIVNVTPDSFSDGGQHADAVLALRHAQTLVEQGADILDIG
GESSRPGSPRLSHAQEWARIAPVLQETVRWNVPVSVDTYQPETMRRALDLGADIINDIHA
LQRPGALEVVAASKAGVCLMHMQGDPASMQQAPHYADVLGEVREFLWSRAATAESMGIDR
SRIALDPGFGFGKTLEHNLTLAKGLPALAQSGYPVLVGVSRKSMIGALTGRDVGERLPGS
LGAVLACVAAGAQIVRVHDVGPTCDAIKVWSAMRA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtcattggaaagcagggcgcttcaccctgcaattgcatcggcccctggtcatg
ggcatcgttaacgtcacgccggattcattttccgatggcgggcagcatgcggatgcggtg
ctcgccttgcgacatgcacagactttggtggagcagggggccgatattctggatattggc
ggcgagtcgtcccgcccgggctctccgcggctgagccatgcgcaggaatgggcgcgcatc
gccccggtcttacaggagaccgtgcgctggaacgtcccggtttcggtggatacttaccaa
cccgaaaccatgcgccgggcactcgatctgggcgcggacatcatcaacgatattcacgct
ttgcagcggccgggcgccctcgaagtggtcgccgcttcaaaggccggggtctgtctcatg
cacatgcagggcgatcccgccagcatgcagcaggcgccgcactatgcggacgttttaggc
gaagtcagggaatttctgtggagccgtgccgctacggccgagtcgatgggtatcgaccga
tcccgcatcgccctcgatccggggtttggctttggcaaaacgctggaacacaatctgact
cttgcgaaaggtttacctgcgctcgcgcaatcgggttatccggtgcttgtgggggtttcg
cgtaaatcgatgatcggcgcactgacggggcgcgatgtgggcgagcgtctgccgggcagc
ttgggcgcagtgctggcttgcgtggcagcgggtgcgcagatcgtgcgcgtccacgacgtt
ggcccgacatgcgacgcgattaaagtgtggagcgccatgcgcgcctga

DBGET integrated database retrieval system