KEGG   Thiomonas intermedia: Tint_1803Help
Entry
Tint_1803         CDS       T01227                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tin  Thiomonas intermedia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tint_1803
   00052 Galactose metabolism
    Tint_1803
   00500 Starch and sucrose metabolism
    Tint_1803
   00520 Amino sugar and nucleotide sugar metabolism
    Tint_1803
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tint_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1934002..1934889
Genome map
AA seq 295 aa AA seqDB search
MPPTITKAVFPVAGLGTRFLPATKATPKEMMPVVDKPLIQYAVEEAYAAGITEMIFVTGR
HKRAIEDHFDTAYELEHQLEEAGKQAMLDVVRSVKPDNVQCVFVRQPVANGLGAAVLCAE
RLVGDEPFAVILADDLLVGEPPVMAQMVDIHSRHGRSVLATEEVPREHTKRYGIVSGQEI
TPGLTSLSGIVEKPAPDVAPSTQAVVGRYILSPRVFHHLRNGKPGAGGEIQLTDGISALL
HEEAVYAYRYSGRRFDCGSKLGYLEATVQLGMSHPETGPEFSAYINNLCTGHAAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgaccatcaccaaagccgtcttccccgttgccggtctcggcacgcgttttctg
cccgcgaccaaagccactccgaaagagatgatgcccgtggtcgacaagccgctcattcaa
tatgcggtcgaagaggcgtacgcggcgggcatcaccgaaatgattttcgtcaccggccgc
cacaagcgcgccatcgaggatcatttcgacaccgcctacgaactggagcatcaactcgaa
gaagcgggcaaacaggccatgctcgacgtggtgcgcagtgtcaaacccgacaacgtgcaa
tgcgtgttcgtgcgccagcccgtggccaacggcctgggcgcggcggtactttgcgccgag
cgtctggtgggcgacgagccgtttgccgtcatcctcgccgatgacttgctcgtcggcgag
ccgcccgtcatggcgcaaatggtcgatattcacagccgccatggccgcagcgtcctcgcc
accgaagaagtgccgcgcgagcacaccaaacgctacggcatcgtcagcgggcaggaaatc
acacccgggctgacctcgctgtcgggcatcgtcgaaaaacccgctccagacgtcgcgccc
agcacccaggcggtcgtgggccgctacatcctcagcccccgcgtgtttcatcatctgcgc
aacggcaagcccggcgccggaggcgaaattcagctcaccgacggcatctccgcgctgctg
catgaagaagcggtgtacgcctatcgctacagcggccgccgcttcgactgcggtagcaag
ctcggatatctcgaagccacggtgcaactgggcatgtctcaccccgagaccggaccggaa
ttcagcgcctatatcaacaatttgtgcacaggccacgcggcaagttaa

DBGET integrated database retrieval system