KEGG   Thiomonas intermedia: Tint_1803Help
Entry
Tint_1803         CDS       T01227                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tin  Thiomonas intermedia
Pathway
tin00040  Pentose and glucuronate interconversions
tin00052  Galactose metabolism
tin00500  Starch and sucrose metabolism
tin00520  Amino sugar and nucleotide sugar metabolism
tin01100  Metabolic pathways
tin01130  Biosynthesis of antibiotics
Module
tin_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tint_1803
   00052 Galactose metabolism
    Tint_1803
   00500 Starch and sucrose metabolism
    Tint_1803
   00520 Amino sugar and nucleotide sugar metabolism
    Tint_1803
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tint_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADG31172
JGI: Tint_1803
UniProt: D5X226
Position
1934002..1934889
Genome map
AA seq 295 aa AA seqDB search
MPPTITKAVFPVAGLGTRFLPATKATPKEMMPVVDKPLIQYAVEEAYAAGITEMIFVTGR
HKRAIEDHFDTAYELEHQLEEAGKQAMLDVVRSVKPDNVQCVFVRQPVANGLGAAVLCAE
RLVGDEPFAVILADDLLVGEPPVMAQMVDIHSRHGRSVLATEEVPREHTKRYGIVSGQEI
TPGLTSLSGIVEKPAPDVAPSTQAVVGRYILSPRVFHHLRNGKPGAGGEIQLTDGISALL
HEEAVYAYRYSGRRFDCGSKLGYLEATVQLGMSHPETGPEFSAYINNLCTGHAAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgaccatcaccaaagccgtcttccccgttgccggtctcggcacgcgttttctg
cccgcgaccaaagccactccgaaagagatgatgcccgtggtcgacaagccgctcattcaa
tatgcggtcgaagaggcgtacgcggcgggcatcaccgaaatgattttcgtcaccggccgc
cacaagcgcgccatcgaggatcatttcgacaccgcctacgaactggagcatcaactcgaa
gaagcgggcaaacaggccatgctcgacgtggtgcgcagtgtcaaacccgacaacgtgcaa
tgcgtgttcgtgcgccagcccgtggccaacggcctgggcgcggcggtactttgcgccgag
cgtctggtgggcgacgagccgtttgccgtcatcctcgccgatgacttgctcgtcggcgag
ccgcccgtcatggcgcaaatggtcgatattcacagccgccatggccgcagcgtcctcgcc
accgaagaagtgccgcgcgagcacaccaaacgctacggcatcgtcagcgggcaggaaatc
acacccgggctgacctcgctgtcgggcatcgtcgaaaaacccgctccagacgtcgcgccc
agcacccaggcggtcgtgggccgctacatcctcagcccccgcgtgtttcatcatctgcgc
aacggcaagcccggcgccggaggcgaaattcagctcaccgacggcatctccgcgctgctg
catgaagaagcggtgtacgcctatcgctacagcggccgccgcttcgactgcggtagcaag
ctcggatatctcgaagccacggtgcaactgggcatgtctcaccccgagaccggaccggaa
ttcagcgcctatatcaacaatttgtgcacaggccacgcggcaagttaa

DBGET integrated database retrieval system