KEGG   Thiomonas intermedia: Tint_1854Help
Entry
Tint_1854         CDS       T01227                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tin  Thiomonas intermedia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tin00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tint_1854
DNA repair and recombination proteins [BR:tin03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tint_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1991233..1991844)
Genome map
AA seq 203 aa AA seqDB search
MHEAAPGHVPALDALIDALRHLPGVGPKSASRMAYHLLEHDREAAQHIARALDAALGAVQ
RCTRCNTLTEDAVCSICADPRRDARQLCVVESPADLAAVEQTLTYHGLYFVLMGRISPLD
GLGPKEIGLDRLMTRALDGAVEEVILATNFTNEGEATAHVIAETLRPRGLRVTRLARGVP
AGAELEYVDLGTIARALVDRRGT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaggccgcgcccggccatgtgcccgcgctcgacgcgctgatcgacgccctgcgg
catttgcctggcgtcgggccgaagtcggcgtcgcgtatggcctatcacctgctcgaacac
gaccgcgaggccgcgcagcacatcgcccgcgcgctagacgcggcgctgggcgcagtgcaa
cgctgcacgcgctgcaacaccctcaccgaagacgcggtctgcagcatctgcgccgacccc
agacgcgacgcccgccagctttgcgtggtggaaagccccgccgatctcgccgcggtagag
cagacgctaacctaccacggcctgtatttcgtgctcatgggccgcatcagcccgctcgat
ggcctggggccgaaggaaatcggtctcgaccggctgatgacccgcgcgctcgacggcgcg
gtggaagaggtgattctggcgaccaacttcaccaacgaaggcgaggcgacggcgcatgtc
atcgccgaaaccctgcgtccgcgcggcctgcgcgttacccgcctggcgcgcggcgtgccc
gccggggccgagctggaatatgtcgatctgggcaccatcgcccgcgcactggtcgaccgg
cgcggcacttga

DBGET integrated database retrieval system