KEGG   Thiomonas intermedia: Tint_1965Help
Entry
Tint_1965         CDS       T01227                                 

Definition
hypothetical protein
Orthology
K09803  
hypothetical protein
Organism
tin  Thiomonas intermedia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2103319..2103585
Genome map
AA seq 88 aa AA seqDB search
MDYEFDLSKDESNLDKHGLSLAEAEGFEWEAAVVREDTRKQYAEQRFEATGYIGERLHVM
VYCLRPDAVRVISLRKANTREVKRYAET
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggactacgaattcgacctatccaaagacgaaagcaacctcgacaagcatggcttgtcg
ctagccgaagctgaaggctttgagtgggaagcagcggtggttcgtgaggacacgcgcaag
cagtacgccgagcaaagatttgaagccaccggttacatcggcgaacgtctgcacgtgatg
gtctattgcctgcgacccgatgcagtccgcgtcatcagcctgcgcaaggcaaacacgaga
gaggtgaagcgctatgccgaaacttaa

DBGET integrated database retrieval system