KEGG   Thiomonas intermedia: Tint_2070Help
Entry
Tint_2070         CDS       T01227                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tin  Thiomonas intermedia
Pathway
tin00010  Glycolysis / Gluconeogenesis
tin00620  Pyruvate metabolism
tin00640  Propanoate metabolism
tin00680  Methane metabolism
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
tin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_2070
   00620 Pyruvate metabolism
    Tint_2070
   00640 Propanoate metabolism
    Tint_2070
  Energy metabolism
   00680 Methane metabolism
    Tint_2070
Enzymes [BR:tin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tint_2070
Lipid biosynthesis proteins [BR:tin01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tint_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADG31421
JGI: Tint_2070
UniProt: D5X363
Position
complement(2202977..2204956)
Genome map
AA seq 659 aa AA seqDB search
MSDTVTHPHERKVYYPSQQTVQSARISGMDAYRALCAEAEADYTGFWARMARENLQWQQP
FTHALDDSQAPFYKWFDDGRLNVSFNCLDVHVQADKGDKTAIVFETDDGAVTRVSYAELL
DRVGRFANALKSLGVNKGDRVVIYMPMSIEGVVAMQACARIGATHSVVFGGFSAQSLRDR
IEDAGAVLVITADEQRRGGKSLPLKAIVDEALALGGCDTIRHVVVYQRTGGNVAFTAPRD
LWMHELSAAQSPDCPPVWVEAEHPLFLLYTSGSTGKPKGVQHSSAGYLLWAKLTMLWTFD
IRPDDLFWCTADIGWVTGHSYIAYGPLACGATEIMFEGVPTFPDAGRFWKMIEQHKVTIF
YTAPTAIRSLIKAAETNPAVHPRNYKLDSLRILGTVGEPINPAAWEWYYEHIGGGRCPIV
DTWWQTETGGHMITPLPGATPMVPGSCTLPLPGITAEVVDETGHDVPWGTGGILVIKKPW
PAMIRNIWGDPERFKKSYYPEELGGYYLAGDGAIRDANDGYFTITGRIDDVLNVSGHRMG
TMEIESALVSHPLVAEAAVVGRPDDITGEAICAFVVLKRPRPEGEEALKIAAELRNHVGV
EIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAVTQDTSTLENPAILDQLGKTH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccgtcacacacccgcacgaacgcaaggtttattacccctcccagcaaacc
gtgcagtccgcccgcatttccggcatggacgcctatcgcgccctatgcgccgaggccgag
gccgattacaccggcttctgggcgcgcatggcgcgggaaaatctgcaatggcagcaaccc
ttcacccacgcactcgacgacagccaggccccgttctacaaatggttcgacgatggtcgg
ctcaatgtgtccttcaactgcctggatgtgcacgtgcaggccgacaagggcgacaagact
gcgatcgtgttcgagaccgatgacggcgccgtcacccgcgtgagttacgccgaattgctc
gacagggtgggccgctttgccaacgcactcaaatcgctcggggtgaataagggcgaccgc
gtggtgatctatatgcccatgtcgattgagggcgtggtggccatgcaggcctgcgcccga
atcggggccacgcactcggtcgtgttcggcggtttttcggcgcagtcgctgcgcgaccgt
atcgaagatgcaggcgccgtactggtgatcaccgccgacgaacagcgacgcggcggcaaa
tcgctgccgctcaaagccatcgtcgacgaggctctggcgctcggcggctgcgacaccatt
cgacatgtcgtggtctatcagcgaaccggtggtaacgtggccttcaccgccccccgcgat
ctctggatgcacgaactgtccgcagcccagagcccggattgcccgccggtttgggtcgag
gccgaacatcccctgtttctgctctacacctccggctccaccggcaaacccaagggcgtg
cagcattccagcgcgggttatctgctctgggccaagctgaccatgctctggactttcgac
atccgcccggacgacctgttttggtgtaccgccgacatcggctgggtgaccgggcacagc
tacatcgcctacggcccgctggcttgcggcgccaccgaaatcatgttcgagggtgtgccg
acctttccagacgccggacgcttctggaaaatgatcgagcaacacaaggtcaccattttc
tacaccgcgcccacggccatccgctcactcatcaaggcggcagagaccaaccccgccgtg
cacccgcgcaactacaagctcgacagcctgcgcatccttggcaccgtcggcgagcccatc
aaccccgcggcctgggagtggtattacgagcacatcggcggcggtcgctgccctattgtc
gacacttggtggcagaccgagaccggcggccacatgattaccccgttgcccggcgcgacg
cccatggtgcccggttcctgcactctgccactgcccggcatcaccgccgaagtggtggac
gaaaccggccacgatgtgccttggggcaccggtggcattctggtcatcaaaaagccctgg
ccagccatgatccgcaacatctggggcgatcccgaacgcttcaagaaaagctattaccca
gaagaactgggcggctactacctggcaggcgatggcgccattcgcgacgccaatgacggc
tacttcaccatcaccggccgcatcgacgacgtgctcaacgtctccggccaccgcatgggc
acgatggagatcgaatccgccttggtttcgcacccgctggtggccgaagccgccgtggtc
ggccgtccggatgacatcactggcgaagccatctgcgcgttcgtcgtgctcaaacgcccc
cggcctgagggcgaggaagccctgaaaatcgcggccgaactgcgcaaccatgtgggcgtg
gaaatcggccccattgccaagccgaaggacattcgcttcggcgacaacctgcccaagacg
cgctccggcaagatcatgcgtcgcctcttgcgttctctggccaaaggagaggctgtcacc
caggatacctctacgctcgaaaatcccgccatcctcgaccaactcggcaaaacgcattga

DBGET integrated database retrieval system