KEGG   Thiomonas intermedia: Tint_2111Help
Entry
Tint_2111         CDS       T01227                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tin  Thiomonas intermedia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tint_2111
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tint_2111
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tint_2111
Enzymes [BR:tin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tint_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2254421..2255863)
Genome map
AA seq 480 aa AA seqDB search
MRYLSTRGESATRGFSDILLEGLAPDGGLYLPESYPQIDRATLAQWRGLSYADLAYEILS
RFITDIPADDLRALIAKTYTPEVFGGHAEIVPLKPLKGDPGMALLGLSEGPTLAFKDMAM
QLLGNLFEYALARQHSELNIFGATSGDTGSAAEYAMRGKRGIRVFMLSPFGKMSAFQTAQ
MYSLADANIHNIAVQGVFDDAQDMVKAVSNDLDFKRRWRIGTVNSINWARLAAQIVYYFA
GYFQATRSNDEQVSFTVPSGNFGNICAGHVARMMGLPIRKLVLATNENNVLDEFFRTGVY
RPRKSAETHHTSSPSMDISKASNFERFIFDLLGRDASRVHALFADELPSKGFFDLSADPA
FARIATDYGFASGSSTHADRLATIRSVWQGSERLIDTHTADGVKVAREHLEPGVPMLVLE
TALAAKFPETIQEAVGTCPQRPAGLEDLERRPQRFAVMPVEVEAVKSYIAMHCGAGLAGS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctgagcacccgcggcgagtccgcgacccgaggtttttccgacatcctgctc
gaagggctggcgcccgatggcgggctctatctgcccgaaagctatccgcagatcgatcgc
gccacgctggcgcaatggcgcgggctgtcttacgccgatctggcgtatgaaatcctgtcg
cgtttcatcaccgacatcccggccgacgatttgcgcgccctgatcgccaagacctacacg
cccgaggtgttcggcggccacgccgagatcgtgccgctcaaaccgctgaaaggcgatccg
ggcatggcgctgctgggcttgtccgaagggcccacactggcgttcaaggacatggccatg
cagttgctcggcaatctgttcgagtacgcgctggcccgccagcacagcgaactcaatatt
ttcggcgcgacctcgggcgataccggcagcgcggccgaatatgccatgcgcggcaagcgc
ggtattcgcgtgttcatgctctcgcccttcggcaagatgagcgcgttccagaccgcgcag
atgtattcgctggccgacgccaacatccacaacatcgcggtgcaaggcgtgttcgacgat
gcgcaggacatggtcaaggccgtgtccaacgacctcgacttcaagcgccgctggcgcatc
ggcacggtcaactccatcaactgggcgcggcttgcggcgcagatcgtctattacttcgcc
ggttacttccaggccacgcgcagcaacgacgagcaggtgagcttcaccgtcccgtcgggc
aacttcggcaacatctgcgccgggcatgtggcgcgcatgatgggtctgccgatccgcaag
ctggtgctggccacgaatgagaacaacgtgctcgacgagttcttccgcaccggcgtctac
cgtccgcgcaaatcggcggaaacacatcacacctccagcccgtcgatggatatctccaaa
gcctcgaacttcgagcgcttcatcttcgatttgctcggacgcgacgcttcgcgcgtgcac
gcgctgttcgcggacgaactgccgagcaagggctttttcgacctctcggccgacccggcg
tttgccaggattgcgaccgactacggcttcgcctcgggcagcagcacccatgccgaccgg
ctcgccaccatccgcagcgtgtggcagggcagcgaacggttgatcgacacccataccgcc
gacggcgtgaaggtggcgcgcgagcacctggagccgggcgtgcccatgctggtgctcgaa
acggcgctggccgccaagttccccgaaacgattcaggaagccgtgggtacctgcccgcag
cgcccggccggactcgaagacctcgaacgccgcccgcagcgctttgccgtcatgccggtc
gaggtggaggcggtgaagtcctatattgcgatgcactgcggcgcggggttggcgggctcc
tga

DBGET integrated database retrieval system