KEGG   Thiomonas intermedia: Tint_2270Help
Entry
Tint_2270         CDS       T01227                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tin  Thiomonas intermedia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tint_2270
   01230 Biosynthesis of amino acids
    Tint_2270
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_2270
   00051 Fructose and mannose metabolism
    Tint_2270
   00562 Inositol phosphate metabolism
    Tint_2270
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tint_2270
Enzymes [BR:tin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tint_2270
Exosome [BR:tin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tint_2270
  Exosomal proteins of bladder cancer cells
   Tint_2270
  Exosomal proteins of melanoma cells
   Tint_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2429000..2429749)
Genome map
AA seq 249 aa AA seqDB search
MRQQFVAGNWKMHGSLASNAALLAEVLAGVGTARCEVAICVPYPYLSQVQQLLQTSQVAL
GAQDCSVHQSGAHTGEVSVSMLQDFGCRYVIVGHSERRADHHESDVLVAAKAERALEAGM
TPIVCVGETLAERESGLTRAVVLRQLLAVTHLLREQTSRIVVAYEPVWAIGTGRTATPEQ
AQEVHAVLREHLRTVSEAAAGVRILYGGSVKPDNAAVLFSQADIDGGLIGGASLKAADFL
AITAATRQD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcaattcgtcgcaggaaactggaaaatgcatggcagcctggcgagcaatgcc
gcgctgctggccgaggttcttgccggcgtaggaaccgcgcgttgtgaagtggcgatctgc
gtgccctatccctatctctctcaagtgcaacaactgctgcagaccagccaggttgcgctc
ggggcgcaggattgttcggtgcatcaaagtggcgcacacacgggcgaagtgtccgtgagc
atgctgcaggattttggctgccgctatgtcatcgtcggccactccgagcgccgtgccgat
catcatgaatccgatgtgcttgtcgcggccaaggccgagcgtgcgctcgaagcgggcatg
acgcccatcgtttgcgtgggagaaacactggctgagcgggagtcggggctgacccgtgcc
gtggtgctgcgtcagttgctggcggtcacccatcttctgcgagagcagacatcgcgcatc
gtcgtggcttacgagcccgtctgggcgatcggcacgggccgcacggcgaccccggagcag
gcgcaagaagttcacgctgtgctgcgggagcatctgcgcacggtgagcgaagccgctgcg
ggtgtgcggattctgtacggcggcagtgtgaagcccgacaatgcggcggtgttgttttcg
caggccgacatcgatggcggcctgatcggtggggcgtcgctcaaggcggccgattttctg
gcgatcaccgcggcgacgcgccaagactga

DBGET integrated database retrieval system