KEGG   Thiomonas intermedia: Tint_2323Help
Entry
Tint_2323         CDS       T01227                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tin  Thiomonas intermedia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tint_2323
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tint_2323
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tint_2323
Enzymes [BR:tin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tint_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2486231..2487109)
Genome map
AA seq 292 aa AA seqDB search
MKQPPDSLRSSPPEGVSVPSGRPRGTDMNRIDQRFAQLRAQNRKALIPYIAAGDPAPSVT
VEVMHALVQGGADVIELGVPFSDPMADGPVIQRATERAITKGIGLPQVLDFVRDFRQTDA
VTPVVLMGYANPVERYGVEAFVAAAKAAGVDGVLIVDYPPAESEAFAAALKAADIAPIFL
LAPTSTDARMADVGRIASGYVYYVSLKGVTGAGHLDTSAVAAMLPRIRAHVQVPVGVGFG
IRDAQTARAIGQLADAVVIGSRLIELMEAQPAEQAAEVARGFIQDIRQALDA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccccctgactcgttgcgctcatctccccccgagggggtgtcggttccttcg
gggcggccgcggggaaccgacatgaaccgcatcgaccaacgcttcgcccagcttcgcgcc
cagaatcgcaaggcgctcattccctacatcgctgcaggcgatcccgcgccttcagtcacc
gtcgaggtgatgcacgccctggtgcagggcggcgccgatgtgatcgagctcggcgtaccg
ttttccgatcccatggccgacggcccggtgattcagcgcgccaccgagcgggccattaca
aaaggcatcgggctgccccaggtgctcgatttcgtgcgcgatttccgccagaccgatgcc
gtcacccccgtggtgctgatgggttacgccaacccggtggagcgctacggcgtggaggcc
tttgtggctgcggccaaagctgcgggcgtggatggcgtgctcatcgtcgattacccgccg
gcggagagcgaggcttttgccgcagcgctcaaggccgcagacatcgcccccatttttctg
ctcgcccccaccagcacggacgcgcgtatggccgacgtgggccgtatcgccagcggctat
gtgtattacgtctcgctcaagggcgtgaccggcgcgggccatctcgacacctcagccgtg
gcggccatgctgccccgcatccgcgctcatgtgcaggtgcccgtgggagtaggattcggc
attcgcgatgcgcagactgcgcgcgcgatcggccagctggccgatgccgtggtcattggt
tcgcgactgatcgaattgatggaggcgcagcccgcagaacaggcggcagaggttgcgcgc
ggcttcatccaagatattcgccaggcgctcgacgcttaa

DBGET integrated database retrieval system