KEGG   Thiomonas intermedia: Tint_2324Help
Entry
Tint_2324         CDS       T01227                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tin  Thiomonas intermedia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tint_2324
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tint_2324
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tint_2324
Enzymes [BR:tin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tint_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2487106..2488341)
Genome map
AA seq 411 aa AA seqDB search
MFDYAYPDASGHFGPYGGSFIAETLSHALEELQAAYDHYKNDPQFLAEYRYELKHFVGRP
SPVYHAARLSDKLGGARIYLKREDLNHTGAHKINNTIGQAMLARRMGKPRVIAETGAGQH
GVATATIAARYGMECVVYMGSEDVKRQSPNVYRMNLLGARVVPVESGSKTLKDALNEALR
DWVTHVEDTFYIIGTVAGPHPYPQMVRDFQRVIGDECLEQMPEMTGRQPDAVIAAVGGGS
NAMGIFYPYIPHESVRLIGVEAAGLGLDTGKHAASLSAGTPGVLHGNRTYLLQDANGQII
ETHSVSAGLDYPGVGPEHAWLKDLGRAEYVGITDDEALAAFHELCRIEGIIPALESSHAL
AHAIKLAPQMRPDQIILVNLSGRGDKDINTVAEREGVSFDTLFARQPGATK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactatgcctatcccgacgccagcggccatttcggcccctacggcggtagcttc
attgccgaaaccctgagccacgcgctggaagagctccaggcggcttacgaccattacaaa
aacgatccgcagttcttggctgaataccgctacgaactcaagcacttcgtcggccgtccc
agcccggtttatcacgccgcccgcctgagcgacaagctcggcggcgcgcgcatctacctc
aaacgcgaagacctcaatcacaccggcgcgcacaaaatcaacaacaccatcggccaggcc
atgctggcccgccgcatgggcaaaccgcgcgtcatcgccgaaactggcgcgggacagcac
ggcgtggccacggccaccatcgccgcgcgttacggcatggaatgcgtggtgtacatgggc
agcgaagacgtcaagcgccaatcgcccaatgtctatcgcatgaatctgctgggcgcgcgc
gtggtgccggtcgaatcgggcagcaagacactcaaggatgcgcttaacgaagcgctgcgc
gactgggtcacgcatgtcgaagacaccttttacatcatcggcaccgttgcggggccgcat
ccctacccgcagatggtgcgcgatttccagcgggtcatcggcgacgaatgcctggagcag
atgcccgagatgaccggccgccagcccgatgcggtgatcgccgccgtgggcgggggcagc
aacgccatgggcattttctatccctacattccccatgaatcggtgcggctcatcggggtc
gaagccgccggtctggggctggacacgggcaagcatgccgcctcgctgtccgcaggcacg
ccaggtgtgctgcacggcaaccgcacctatttgctgcaggacgccaacggtcagatcatc
gaaacgcattccgtatccgccgggctcgactatcccggtgtcggccccgagcatgcctgg
ctcaaagatctcgggcgggccgagtacgtcggcattaccgacgacgaggctctggcggcc
ttccacgaactgtgccgcatcgagggcatcatcccggcgctggaatccagccacgctctg
gcgcatgccatcaagctggcgccgcaaatgcgtcctgatcagatcattctggtcaatctc
tcggggcgcggcgacaaagacatcaacaccgtggccgagcgcgaaggcgtgagcttcgac
accctgttcgcccgccagcctggagccacaaaatga

DBGET integrated database retrieval system