KEGG   Thiomonas intermedia: Tint_2339Help
Entry
Tint_2339         CDS       T01227                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tin  Thiomonas intermedia
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tint_2339
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tint_2339
   00650 Butanoate metabolism
    Tint_2339
  Energy metabolism
   00190 Oxidative phosphorylation
    Tint_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2503385..2503750)
Genome map
AA seq 121 aa AA seqDB search
MAADKIGNKRLVVGAHYGLRDWMAQRVTAAVIAVFTLVLLVYFLAPGPLSYERWHDLFAQ
QWMKLLTFVTVLALTYHVWVGMRDIWMDYVKPVGVRLLLQIGTILWLLACAGWALQVLWR
A
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgacaagattggaaacaagcgcctggtcgtcggcgcgcactacggcctgcgc
gactggatggcgcagcgcgtcaccgccgccgtgatcgcggtgttcaccctggtgttgcta
gtgtattttctcgcgcccggcccgctgagctacgagcgctggcacgatttgttcgcccag
cagtggatgaagctgctgaccttcgtgacggtgctggcgctcacctaccacgtctgggtg
ggcatgcgcgacatctggatggattacgtcaaaccggtcggcgtgcgactgctgctgcag
atcggcaccattttgtggctattggcttgcgcgggctgggccctgcaagtgttgtggaga
gcgtaa

DBGET integrated database retrieval system