KEGG   Thiomonas intermedia: Tint_2374Help
Entry
Tint_2374         CDS       T01227                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tin  Thiomonas intermedia
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tint_2374
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tint_2374
Enzymes [BR:tin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tint_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2536890..2537975)
Genome map
AA seq 361 aa AA seqDB search
MQLLMHSPLILDVAGLQLGAADRKRLRNPLVGGVVLFARNWESRGQLLSLCAQIKAVRPD
LLIAVDHEGGRVQRFRTDGFTALPAMRELGAHWMADAPGAMRRAAACGFVLASELRACGV
DFSFTPVLDLDWGGSSVIGDRAFHADARVVTVLAQSLMLGLARAGMVHCAKHFPGHGYVR
ADTHLAVARDARTLDAILSADAAPYQWLAPGLRAVMPAHVIYPEVDALPAGFSSVWLRDV
LRERIGFTGAILSDDLGMAAARAEGQSLSQAALQGLQAGCDAMLVCNQSVVDNGRPLDVL
LRELDQALERGQWTPDVHSAQRRLDLLPTQPPLEWDELMVSDSYRAALDDVFNLPSSAGQ
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgctgatgcactcaccgttgatcctcgatgtggccgggctgcaactcggcgcc
gccgatcgcaagcgcctacgcaatcctctggtgggcggggtggtgctgtttgcgcgcaac
tgggagagccgcgggcagctcttgtcgctgtgcgcgcagatcaaggcggtacgccctgat
ctgttgatcgcggtcgatcacgagggcgggcgggtgcagcgctttcgcaccgatggcttc
acggcacttccggcgatgcgcgagcttggggcgcattggatggctgatgccccaggcgcc
atgcggcgcgcggcggcgtgcggtttcgtgttggcctcggagctgcgggcttgcggggtg
gatttcagcttcacgcccgtgctcgatctcgattggggcggctccagtgtgatcggtgat
cgcgcgtttcacgccgatgcgcgggtggtgacggtgctggcgcaaagcctgatgctgggt
ttggcgcgtgcgggcatggtgcattgcgccaagcacttccccggccacggctatgtgcgt
gccgacacgcatctggccgtggcgcgcgacgcgcgcaccctcgacgccattctgagcgcc
gatgccgcgccttatcaatggttggcgcccgggctgcgcgcggtcatgccggcgcatgtg
atctaccccgaggtggatgcgctgcccgcagggttcagctccgtctggctgcgggacgtg
ctgcgcgagcgcatcggttttaccggcgcgatactcagcgacgacctcggcatggccgcg
gcgcgggccgagggtcaaagtctcagccaggctgcgctgcagggtttgcaggccggatgc
gacgccatgctggtgtgcaaccagagcgtggtcgataacgggcgaccgctcgacgtgctg
ctgcgcgagcttgatcaggcgctggagcgcgggcagtggacgcccgatgtccacagcgcc
cagcgccgcctcgacctgctgcccacccagccgcctttggaatgggacgagctcatggtg
agcgacagctaccgggccgcgctcgacgacgttttcaacctgcccagctcggcgggccag
aaatag

DBGET integrated database retrieval system