KEGG   Thiomonas intermedia: Tint_2420Help
Entry
Tint_2420         CDS       T01227                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tin  Thiomonas intermedia
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tin01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tin01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2581714..2582919)
Genome map
AA seq 401 aa AA seqDB search
MFDVFLNWAGHGLLRASWWQIVLFALITTHITIASVTIFLHRAQAHRALELHPIASHFFR
FWLWFTTGMVTKEWVAIHRKHHAKCETVDDPHSPVTRGIDTVLLRGAELYRTESRNAETL
SKFGHGTPDDWLERNVYSRFIWQGVGLLLILDVLMFGAIGATVWAVQMLWIPIWAAGVIN
GLGHWWGYRNFSARDSSHNISPWGLLIGGEELHNNHHTYPTSAKLSVKWWEFDIGWAYIR
ALSWVGLAKPRKLPPQFRLGEVRAEVDQLTLQAVIANRYELMARYAAGLKSTLKAELARA
AEQGAVSHLPTLRAAKRWIGIEREILCERSRALVDAAASASPNLSKLLHMREELKSVWEQ
TNLNAEQLRLKLQDWCRRAEDSGLAPLRELSLRLRRYTPTA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgtgtttttgaattgggctgggcacggccttttgcgtgcatcgtggtggcaa
atcgtcttatttgcgctcattaccacgcatatcaccattgcgtccgtcactatttttctg
caccgcgctcaggctcaccgagcgctggaactgcacccgatcgcctcgcactttttccgc
ttctggctgtggttcaccacgggcatggtcaccaaggaatgggtggcgattcatcgcaag
catcacgccaagtgcgagacggtcgacgaccctcacagtccggtgacgcgcggcatcgat
acggtgctgttgcgcggcgccgagttgtaccgaaccgaatcgagaaacgccgaaaccttg
agcaaattcggtcacggcactcctgacgactggttggagcgcaacgtttattcccgattt
atctggcagggcgtcgggcttttgctcattctcgatgtgctgatgttcggcgcgatcggc
gccacggtgtgggccgtgcagatgttgtggattccgatctgggcggctggggtgatcaac
gggctgggtcattggtggggctatcgcaatttttcggcgcgagacagcagccacaatatt
tcgccctgggggttgctgatcggcggcgaagagttgcacaacaaccaccacacctatccc
acgtcggccaagctctcggtcaaatggtgggagttcgatatcggctgggcctatatccgc
gctttgtcctgggtgggtttggccaaaccacgcaaactgccgccgcagttccggctgggc
gaggtgcgcgccgaggtcgatcaactcactttacaagctgtcatcgccaaccgttatgaa
ttgatggcgcgctatgccgcggggttgaagtccaccctcaaggccgagctggcccgggct
gctgaacagggcgcggtgagccatctgccgactttgcgcgcagccaaacgctggatcggc
atcgagcgcgagattctgtgcgagcgttcgcgcgccttggtggacgcggcggcaagtgcc
agccctaacctgagcaagctgcttcacatgcgcgaagagctcaaatcggtgtgggagcag
accaatctgaacgccgaacagcttcgcctgaagctgcaggactggtgccgccgcgccgaa
gacagtggcctggccccgcttcgggagttgtcgctgaggctgcgacgttatacgccgaca
gcctga

DBGET integrated database retrieval system