KEGG   Thiomonas intermedia: Tint_2429Help
Entry
Tint_2429         CDS       T01227                                 

Definition
6,7-dimethyl-8-ribityllumazine synthase
Orthology
K00794  
6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
tin  Thiomonas intermedia
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:tin00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2590181..2590666
Genome map
AA seq 161 aa AA seqDB search
MQNVQNRILSEQLDGRELRVAVVQARFNTAITDRITQSCLDELQRLGVNEDDIGLYTVPG
ALELPLMLQALAESEAFDALIAIGCVIRGDTYHFEVVCNTSAAGIAQVALDYNMPVANGV
LTVENEAQAEARIDKGAECARVAVEMANLFIDISDNDDEAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgtccagaaccgcattctttccgaacaactcgatggccgtgagctgcgcgtc
gccgtggtgcaggcccgcttcaacaccgccattaccgaccgcatcacccagtcctgcctc
gacgaactccagcgcctgggcgtgaacgaagacgatatcgggctctacaccgtccccggc
gcgctcgaactgccgctgatgctgcaggcgctggccgagagcgaggcgttcgatgcgctc
attgccatcggctgcgtgattcgcggcgacacctatcacttcgaggtcgtctgcaatacc
agcgccgccggtatcgctcaggtggcgctcgactacaacatgccggtggccaacggcgtg
ctcaccgtggaaaacgaagcgcaggccgaagcccgcatcgacaaaggcgccgaatgcgcc
cgcgtcgcggtggaaatggccaacctgttcatcgacatcagcgacaacgacgacgaggcc
gcatga

DBGET integrated database retrieval system