KEGG   Thiomonas intermedia: Tint_2501Help
Entry
Tint_2501         CDS       T01227                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tin  Thiomonas intermedia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Tint_2501
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tint_2501
Enzymes [BR:tin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Tint_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2658673..2659278
Genome map
AA seq 201 aa AA seqDB search
MHRTTLNPISRFAAAALLALGAQLFSPSASAAQSAPAASATCPALLNQTFPRLQDDKPES
LCQYAGKVILVVNTASYCGFTPQYKGLEALYREYGKQGLVVLGFPSNDFHQEMDNNAKIA
AFCKDTYNVQFPMFAPSHVTEPKPNALFEQLILATGDQPKWNFYKYLIGRDGKVVGVYPS
LVSPDNKDFVAKIKTLLAQKP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcactacgcttaacccgatctctcgcttcgcagcagccgcgctgctcgcgctt
ggcgcccagctgttcagcccgtccgcttccgcagctcagtcggcgcccgcagcgtcggcc
acctgccctgccctgctcaaccagaccttcccccgccttcaagacgacaagcccgaaagc
ctttgccaatacgcgggcaaagtcatcctcgtggtcaacacggccagctattgcggcttc
accccgcaatacaaggggctggaggcgctgtaccgcgagtacggcaagcagggcctggtg
gtgctgggctttccgtccaacgatttccatcaggaaatggacaacaacgccaaaatcgcc
gcgttctgcaaggacacctacaacgtgcaattcccgatgttcgcgccctcgcacgtcact
gagcccaagccgaacgcgctgttcgaacagctcatcctcgccaccggcgatcagcccaag
tggaacttttacaaatacctgatcggccgcgacggcaaggtcgtgggcgtctatcccagc
ctggtctcgccagacaacaaagactttgtcgccaagatcaagactctgctcgcgcagaaa
ccctga

DBGET integrated database retrieval system