KEGG   Thiomonas intermedia: Tint_2548Help
Entry
Tint_2548         CDS       T01227                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tin  Thiomonas intermedia
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tint_2548
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tint_2548
Enzymes [BR:tin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tint_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2714097..2715065
Genome map
AA seq 322 aa AA seqDB search
MTRAHNPQLNKNGELRHLLTPEGLPRDVLTHILDTAQGFVSFGSREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAQRLSADVFNLDIQRSSTSKGESLLDTIANLEAMDADVFVVRHS
DSGAPFLIAQHTPPHVHIVNAGDGRHAHPTQGLLDMYTIRHFKGDFSNLTVAIVGDIVHS
RVARSAIHALTTLGAAEVRAVGPKTLAPDNLRDMGVRVCHDMAEGIRGADVIMMLRLQNE
RMSGALLPSAHEFNMTYGLTPERLALAKPDVIVMHPGPINRGVEIDSAVADGPRSVILDQ
VRFGIAVRMAVLSIVASTESPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcccataacccccaactcaacaaaaacggcgagctgcgccacctgctcacc
cccgaaggcttgccgcgcgacgtgctcacgcacatccttgacaccgcgcagggttttgtc
agcttcggcagccgcgaagtgaaaaaagtgccgttgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaacagcacccgcacccgcaccactttcgagatcgcggcgcagcgcctg
tcggccgacgtgttcaatctcgacatccagcgctccagcacgagcaagggcgagagcctg
ctcgacaccatcgccaacctcgaagcgatggatgccgatgtgttcgtcgtgcgccattcc
gacagcggcgcgccctttctcatcgcccagcacacgcccccgcatgtgcacatcgtcaac
gccggcgatggccgtcatgcccaccccacccaggggctgctggacatgtacaccatccgt
catttcaagggcgacttcagcaacctcaccgtggccatcgtcggcgacatcgtgcattcg
cgcgtggcgcgctcggccattcacgcgctcaccacgctgggcgccgccgaggtgcgcgcc
gtcggccccaagaccctggcgcccgacaatctgcgcgacatgggcgtgcgcgtctgccac
gacatggccgagggcattcgcggcgccgacgtcatcatgatgctgcggctgcaaaacgag
cgcatgtcgggtgcgctgctgccgtccgcgcatgaattcaacatgacctacggcctcacg
cccgagcgcctggcactggccaagcccgatgtcatcgtcatgcatcccggccccatcaat
cgcggcgtcgagatcgacagcgcggtggccgatggcccgcgcagcgtcatcctcgaccaa
gtgcgcttcggcatcgccgtgcgcatggccgtgctgtccatcgtcgcctccaccgaaagc
cccgcatga

DBGET integrated database retrieval system