KEGG   Thiomonas intermedia: Tint_2578Help
Entry
Tint_2578         CDS       T01227                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tin  Thiomonas intermedia
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tint_2578
   00240 Pyrimidine metabolism
    Tint_2578
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tint_2578
   03430 Mismatch repair
    Tint_2578
   03440 Homologous recombination
    Tint_2578
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Tint_2578
DNA replication proteins [BR:tin03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Tint_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2748085..2748510)
Genome map
AA seq 141 aa AA seqDB search
MPCSVEFRVNLPDPLRYACGLLRTATQRGARVLVAAPEPLLTELDPLLWTFQPGSFVPHV
WQDDPLADKTPVILAPLPDLPRAGRVTALVNLGPDLVTGWESLERVIELVSENGPDKPAA
RERLRAYRAAGFDPAIIPSRS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccctgctcggtcgagtttcgtgtgaacctgcccgacccgctgcgttatgcctgcggg
ctgctgcgcacggcgacgcagcgcggcgctcgcgtgctggtagccgcgcccgagcccttg
ctcacggaactcgatccgttgttgtggacttttcagcccggcagttttgtgccgcatgtc
tggcaggacgacccgctcgctgacaaaacgccggtcatcctggcgcccctgcccgatctg
ccccgggccgggcgggtgactgccctggtgaatctcggccccgatctggtgaccggctgg
gaatctctggagcgagtgatcgaactcgtgagtgaaaacgggcccgacaagcccgccgcc
cgcgaacgcctgcgcgcttatcgggccgccggattcgatcccgccatcatcccgtcccga
tcatga

DBGET integrated database retrieval system