KEGG   Thiomonas intermedia: Tint_2646Help
Entry
Tint_2646         CDS       T01227                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tin  Thiomonas intermedia
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tin01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tin00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2810875..2812722
Genome map
AA seq 615 aa AA seqDB search
MTWAGKILRVNLTQGTIKSEPLNRQWAREYIGQRGLATKYFVEEVDAKVDPLSPDNKLIY
ATGPLTGTMASTGGRYSVITKGALTGAIACSNSGGYFGAELKMAGWDMIIVEGKSPKPVY
LSIENDKAELLDASPIWGKTVWETEPWIKNHHQDPLIRVSSIGRAGENGVMYAAIVNDLH
RAAGRSGVGTVMGSKNLKAIAVRGTLGVGNVRDPKAFMAAVNAGKKVLHDNAVTGQGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEGAKDISGEAMHEPRKTDGKPNLVTNQACFGCTI
ACGRISKIDEHHFSVENKPQYWGASGGLEYEAAWALGSANGVNDLEALTYANFLCNEDGM
DPITFGATVGAVMELYDMGLLTKEQLGVEAPFGSAKALTYFAEITARGEGFGKELALGSK
RLTAKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLVADGKPELVKAFQDATAVFDSAGICLFTSFAWTLADVQPQLAAACLEEFTMDELNT
IGERIWNMERDYNNRAGFTAKDDTLPPRLLKEPAKTGPAKGLTNKLPEMLPRYYELRGWT
PEGTLKPETRTRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggccggaaaaattctgcgcgtgaacctcacgcaaggcaccatcaagagcgag
ccgctgaataggcagtgggcgcgcgagtacatcggccagcgcgggctggcgaccaagtat
ttcgtcgaggaggtcgacgccaaggtcgatccgctctcgcccgacaacaagctgatctac
gccaccgggccgctcaccggcaccatggcgtccaccggcgggcgctattcggtgattacc
aaaggcgcgctcaccggcgcgatcgcctgctccaactccggcggttacttcggcgccgag
ctgaagatggcgggctgggacatgatcatcgtcgaaggcaaatcgcccaagccggtttat
ctgtccatcgagaacgacaaggccgaactgctcgacgcctcgccgatctggggcaagacc
gtgtgggaaaccgagccctggatcaagaaccatcaccaagacccgctgatccgcgtcagc
tccatcggccgtgcgggtgaaaacggagtgatgtatgcggccatcgtcaacgatctgcac
cgcgccgccggtcgctcgggcgtgggcacggtgatgggtagcaaaaacctcaaggccatc
gcggtgcgtggcaccctgggcgtgggcaatgtgcgcgaccccaaggcgttcatggctgcg
gtcaacgcaggcaaaaaagtgctgcacgacaacgcggtcaccggccaggggctgcccaaa
tacggcacccaggtgttgatgaacgtgatcaacgaaatcggcgccctgcccacgcgcaac
catcgcgacgtgcaattcgaaggcgcgaaagacatctccggcgaggccatgcacgagccg
cgcaaaaccgatggcaagcccaatctggtcaccaaccaggcgtgctttggctgcaccatc
gcctgcggccgcatcagcaagatcgacgaacaccatttcagcgtcgagaacaagccgcag
tattggggcgcatcgggcggtctggaatatgaagctgcctgggcgctgggctcggccaac
ggcgtcaacgatctggaggcgctgacctacgccaacttcctctgcaacgaagacggcatg
gaccccatcactttcggcgccaccgtgggcgcggtgatggagctgtacgacatgggcctg
ctgaccaaggaacaactcggcgtggaagcgcctttcggctcggccaaggcgctgacctac
ttcgccgaaatcaccgcccgcggcgagggcttcggcaaggaactggcgctgggcagcaaa
cgcctgactgccaagtacggccacccggaactgagcatgagcgtcaagggccaagagttc
ccggcctacgactctcgcggcattcaaggcatgggcctggcctatgcgaccagcaaccgc
ggcgcctgccatctgcgcggctacacggtggcttcggaagtgctgggcattccggtcaag
accgacccgctggtggccgacggcaagcccgaactggtcaaggcgtttcaggacgccacc
gccgtgttcgactctgccggtatctgcctgttcaccagtttcgcctggacgctggccgac
gtgcagccgcagcttgccgccgcctgcctggaagagttcaccatggacgaactgaacacc
ataggcgagcgcatctggaacatggagcgcgactacaacaaccgcgcgggcttcaccgcc
aaggacgacaccttgccgccgcgtctgctcaaagagcccgccaagaccggcccggccaag
gggctgaccaacaagctgcccgaaatgctgcctcgctattacgagctgcgcggctggact
ccggaaggcacgctcaagcccgaaacccgcacgcggctcgggctttga

DBGET integrated database retrieval system