KEGG   Thiomonas intermedia: Tint_2661Help
Entry
Tint_2661         CDS       T01227                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tin  Thiomonas intermedia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tin03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2832861..2834936
Genome map
AA seq 691 aa AA seqDB search
MRPAPTNAPSAPTQRVLDVLHDWAEQGVLRRLDAALARLLAELCPQMPPELAVAVALLAD
LEGRGHTCVLLGELPQHFIALKERAATAGAPALSPDVHWPDDGERLLRECPAVYCEGEPD
NGAPLIFSRERRAAPSSLDPLGGRGGPSTTLGAMEAERLYLRRYWRDENTVAARIHQRLQ
PEAAVDAPAAAALLAQLFPPADDTEVDWPKLACALALRGRFTLLTGGPGTGKTHTAARLL
ALLWALRSQPGALRVALAAPTGKAAARLKQSIDRELVKLAALPGVAELSQRLGPARTLHS
LLGARPDTRRFARNAAQPLEVDVLLVDEASMIHLEMMAALLDALPPTARLILLGDKDQLA
SVEAGAVLGELCTGAEQGRYTPQTAQALQALCSDRIPQPFIDPAGPALLQRVVMLRKSHR
FGGAIGQLAQAVNAGDAERAQALLQQADDAAVRLLPVPQLLAPVFSPVLAPVAAPALVDL
AVQGRDGAKGYAHYADLLRQGPTAEADWDAWAQRVLQAFDQCRVLCAVREGPWGVQALNE
AIAARLDALGLLHDRGAWYAGRPVMVTRNDHDLGVLNGDVGIALPTGTQGLRVVFLQGQS
LRSVSISRLADVQTAFAMTVHQSQGSEFDHTVLVLPERHAGLSRELIYTGITRARSFFTL
ACADMQTLHAGIQRVTHRASGLLSRIDKLPA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccgccccgaccaacgcgccgagtgcgccgacccagcgcgtcctcgacgtgctg
cacgactgggcagagcagggcgtgctgcggcggctggacgctgcgctggcccgcttgctg
gctgaactctgcccgcaaatgccgccagaactggcggtagccgtggcgctgctcgccgat
ctggaggggcgcggtcatacctgcgtgctgctgggcgaattgccgcaacacttcatcgcc
ttgaaagagcgcgccgccacggcgggcgcgcctgccctgtcgcccgatgtgcactggccc
gacgacggcgagcgcctgctgcgcgagtgcccggccgtttactgcgagggcgagccggac
aacggcgcgccgctgatattctcaagggaacgcagggccgccccaagttcccttgacccc
ctcggggggcggggcgggcctagcacgaccctgggggcgatggaggcagagcggctgtat
ctgcgccgctactggcgagacgagaacaccgtggccgcgcggattcaccaacgcctgcag
cctgaagccgcggtcgatgcgcccgctgctgcagcgctgctggcacagcttttcccgcct
gccgacgatacggaagtggactggccgaaactggcgtgcgcgctggcgctacgcggacgt
ttcaccctgcttaccggcggccccggtaccggcaaaacacataccgcggcgcggctgctg
gctttgctgtgggctttgagatcccagcccggcgcgctgcgcgtggcgctggcggccccc
acgggcaaggccgcagcccggctcaagcagtccatcgaccgcgagctcgtcaagctcgcc
gccctccccggtgtggccgaactgtctcagcgcctcggcccggcacgcaccctgcacagc
ctgctcggcgcgcggcccgatacccgccgcttcgcccgcaacgccgcgcagcccttggag
gtggatgtgctgctggtcgatgaggcgtccatgatccatctggaaatgatggccgcgctg
ctcgacgccttgccgcccacggcacggctcattctgctgggcgacaaggatcagctcgct
tcggtggaggccggtgcggtgctcggcgagctgtgcaccggggcggagcagggccgctac
acgccgcaaacggcgcaggcgctgcaggctctgtgcagcgaccgcattcctcagcccttc
atcgaccccgccggccccgcgctgttgcagcgggtggtgatgctgcgcaaaagtcatcgc
ttcggcggcgccatcgggcaactggcccaggcggtgaacgcgggcgacgccgagcgggcg
caggcgctgctgcagcaggccgacgatgcggcggtgcggctgttgcccgtaccccagttg
ctcgcgcctgttttctccccggttttagctcctgttgcagccccggcgctggtcgatctt
gcggtgcagggccgcgatggcgccaagggctatgcccactacgccgatttgctgcggcag
gggccgacggctgaggcagattgggacgcctgggcgcagcgcgtgctgcaggctttcgat
cagtgccgcgtgctgtgcgcggtgcgcgaagggccttggggcgtgcaggcgctgaacgag
gccatcgccgcgcggctggacgcgctcggcctgctgcacgatcgcggcgcgtggtacgcg
ggtcgcccggtgatggtcacgcgcaacgatcacgatctgggcgtgctcaacggcgatgtc
ggcatcgccttgccgaccggcacgcagggcttgcgggtggtgtttctgcaggggcagagc
ctgcgctcggtcagcatcagccgtctggccgatgtgcagacggcgttcgccatgacggtg
caccagtcgcaggggtcggagttcgatcacaccgtgctggtgctgcccgagcgccacgcc
gggctcagccgcgagctgatctacaccggcatcacgcgcgcgcgtagcttcttcaccctg
gcctgcgcagacatgcagacgctgcatgcgggcatccagcgcgtcacgcaccgggccagc
ggattgctctcgcgcatcgataaactgcctgcatga

DBGET integrated database retrieval system