KEGG   Thiomonas intermedia: Tint_2665Help
Entry
Tint_2665         CDS       T01227                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tin  Thiomonas intermedia
Pathway
tin00230  Purine metabolism
tin01100  Metabolic pathways
Module
tin_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tint_2665
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tint_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 RsgA_GTPase AAA_33 AAA_16 ABC_tran AAA_18 AAA_25 AAA_22 AAA_23 Dynamin_N cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ADG32006
JGI: Tint_2665
UniProt: D5X689
Position
complement(2838125..2838751)
Genome map
AA seq 208 aa AA seqDB search
MSSQFPGNLFVVAAPSGAGKSSLVNALLAEDSGIQLSVSCTTRAPRGAEVDGVHYVFIDN
PEFQRRIDAGEFLEWAEVHGNRYGTSKRWLESRMADGMDVLLEIDWQGAAQVRKQFDNAV
SIFILPPSFEELRQRLTRRAEDAPEVIEQRLREARIELAQAKNFDFIIVNQDFTHALRDL
KQVVAAQRLRYAAQRLSHPEVFRALGIL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctcccagtttcccggaaacctgtttgtcgtcgccgcccccagtggggcgggcaag
tccagcctcgtcaacgccttgctcgccgaggactcgggcatccagctctcggtgtcttgc
accacgcgcgcgccgcggggcgccgaggtcgatggcgtgcattacgttttcatcgacaac
cccgaatttcagcgccgcatcgacgcaggcgaatttctcgaatgggccgaggtgcacggc
aaccgctacggcacctccaagcgctggctggaaagccgcatggccgacggcatggacgtg
ctgctcgaaatcgactggcagggcgcggcgcaggtgcgcaagcaattcgacaacgcggtg
agcatcttcatcctgccgccctcgttcgaggaactgcggcaacggctcacccgccgcgcg
gaagacgcgcccgaggtcatcgagcagcgtctgcgtgaagcccgcatcgagttggcgcag
gcgaagaacttcgactttataattgtgaatcaagactttacgcacgccttgcgcgatctc
aagcaagtcgtcgccgcgcagcggctacgctatgccgcgcaacgcctttcccatcccgag
gtttttcgcgccctcggcatcctttga

DBGET integrated database retrieval system