KEGG   Thiomonas intermedia: Tint_2700Help
Entry
Tint_2700         CDS       T01227                                 

Definition
Disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tin  Thiomonas intermedia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2873029..2873766
Genome map
AA seq 245 aa AA seqDB search
MNSSLSRSVARVLRGVALSAAFLSLPVMAQTLAETRAALEKAMPGLPASAKIIKTPYAGL
YEVDVGSKIFYTDAKATFLFAGEIFDTKTQTNVTKARIDDLRRVNWKDLPFKDSFKLVFG
NGKRQIAIFEDPYCPYCHKMEATLEKMSNVTLHVFVVPIIRRESMQQARDIWCAPNRSKA
WLDWMNKQVQPPAAAATCVDPLKANVELAEKLGISSTPTLIFTDGDRMEGALPQEEVEKK
LAAVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcgctctcccgctccgttgcgcgcgttctgcgcggggtcgcgctgtccgcg
gcctttctgtctctgccggtcatggcgcaaaccctggccgaaacccgcgccgcactcgaa
aaggccatgccgggtctgcccgccagtgccaagatcatcaaaaccccctatgccgggctg
tatgaagtggacgtgggcagcaagattttttacaccgacgccaaggccacctttttgttc
gcgggcgagattttcgacaccaagacccagaccaacgtcaccaaggcccggattgacgat
ctgcgccgggtgaactggaaggatctgccgttcaaagactcgttcaagctggtgttcggc
aacggcaagcgccagatcgcgatttttgaagacccgtattgcccgtactgccacaagatg
gaagccacgctggaaaagatgagcaacgtcacgctgcatgtgttcgtcgtgcccatcatc
cgccgcgaatcgatgcaacaggcgcgcgacatctggtgcgcccccaaccgcagcaaggcc
tggctggactggatgaacaagcaagtgcagccgcccgcggccgcggcgacttgcgtcgat
ccgctcaaggccaatgtggagctcgcggagaagctgggcatttcgtccacccccacgctg
atcttcaccgacggcgaccgcatggaaggcgccctgccgcaagaagaagtcgaaaagaag
ctggccgcagtcaagtaa

DBGET integrated database retrieval system