KEGG   Thiomonas intermedia: Tint_2700Help
Entry
Tint_2700         CDS       T01227                                 

Definition
(GenBank) Disulfide bond isomerase, DsbC/G-like protein
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tin  Thiomonas intermedia
Brite
Enzymes [BR:tin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tint_2700
Chaperones and folding catalysts [BR:tin03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Tint_2700
Secretion system [BR:tin02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Tint_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N Thioredoxin_4 Thioredoxin_5 Thioredoxin_3 DSBA Glutaredoxin MdcE
Motif
Other DBs
NCBI-ProteinID: ADG32041
JGI: Tint_2700
UniProt: D5X6P4
Position
2873029..2873766
Genome map
AA seq 245 aa AA seqDB search
MNSSLSRSVARVLRGVALSAAFLSLPVMAQTLAETRAALEKAMPGLPASAKIIKTPYAGL
YEVDVGSKIFYTDAKATFLFAGEIFDTKTQTNVTKARIDDLRRVNWKDLPFKDSFKLVFG
NGKRQIAIFEDPYCPYCHKMEATLEKMSNVTLHVFVVPIIRRESMQQARDIWCAPNRSKA
WLDWMNKQVQPPAAAATCVDPLKANVELAEKLGISSTPTLIFTDGDRMEGALPQEEVEKK
LAAVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcgctctcccgctccgttgcgcgcgttctgcgcggggtcgcgctgtccgcg
gcctttctgtctctgccggtcatggcgcaaaccctggccgaaacccgcgccgcactcgaa
aaggccatgccgggtctgcccgccagtgccaagatcatcaaaaccccctatgccgggctg
tatgaagtggacgtgggcagcaagattttttacaccgacgccaaggccacctttttgttc
gcgggcgagattttcgacaccaagacccagaccaacgtcaccaaggcccggattgacgat
ctgcgccgggtgaactggaaggatctgccgttcaaagactcgttcaagctggtgttcggc
aacggcaagcgccagatcgcgatttttgaagacccgtattgcccgtactgccacaagatg
gaagccacgctggaaaagatgagcaacgtcacgctgcatgtgttcgtcgtgcccatcatc
cgccgcgaatcgatgcaacaggcgcgcgacatctggtgcgcccccaaccgcagcaaggcc
tggctggactggatgaacaagcaagtgcagccgcccgcggccgcggcgacttgcgtcgat
ccgctcaaggccaatgtggagctcgcggagaagctgggcatttcgtccacccccacgctg
atcttcaccgacggcgaccgcatggaaggcgccctgccgcaagaagaagtcgaaaagaag
ctggccgcagtcaagtaa

DBGET integrated database retrieval system