KEGG   Thiomonas intermedia: Tint_2705Help
Entry
Tint_2705         CDS       T01227                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tin  Thiomonas intermedia
Brite
Enzymes [BR:tin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Tint_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2876303..2877856)
Genome map
AA seq 517 aa AA seqDB search
MSVTSSTPAVASSAAVQAPASKPRRSHWARRLAIALVVGLAGGGGALAWGMHEQPSIPPV
VWLQHPVQSFTFALGGNPHPVQLALPPQQPLSAVAQLGRQLFFDTALSASGKQSCASCHD
PANGYNPPPGRPKAGFAPLGGSEPTASVGAQQSPPPGSGAVMLGGPNMTSPGFRPPPSLA
YLYRQQPFSIGPDNEENETITLQQLAALGQTSQRAKKTAQSTAQSVQNLVPTGGLFWDGR
VNTLQQQAGGPLFNPVEMDAGTPQRVAAIIERQPYAKTFLQLFGPNVFADPKQTVSEALF
AIARYQIEDPQFHAFNSKYDAWLQGRATLTSQEMRGYLAFNDVNKGDCAACHLDQPTKDH
LPPLFTDTQYEALGVPRNPQIPANQNPHYFDIGLCGPFRTDLKNQTAYCGMFLTPTLRNV
AQRPVYFHNGVYHSLKQVLDFYNFRDVQPGRIYPTVGGQVRKYDDLPPQYRANVDVTDPP
LNRKLGEQPAMTAQDMRDIIAFLHTLNDGYTPLKPVS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcacctcatccacccctgccgtcgcttcttcggccgctgtgcaggcgcctgcg
agcaagccgcgccgctcgcactgggcacgccgcctggccattgcgctggtcgttggcctt
gcggggggcggcggcgcgctggcctggggtatgcacgagcagccgagcattccccccgtc
gtttggctgcagcatccggtgcagagctttactttcgcgctaggcggcaatccgcatccg
gtgcaactcgcgctgccgccgcagcaacccctctcggccgtggcgcaactggggcgtcag
ttgttttttgatacggcgctttcagcctcgggcaagcagtcttgcgcgtcttgtcatgac
ccggcgaatgggtacaacccgccgccgggccgccccaaggcgggtttcgcccccttgggg
ggcagcgagccgacggcgagcgtgggggcgcagcagtccccgccgccgggcagcggggct
gtgatgctgggcgggccgaatatgacttcacccggctttcgcccgccgccgtcgctggcc
tacctctaccggcagcagccgttctccatcggcccggacaacgaggagaacgaaaccatc
accctgcagcaactcgcggcgctggggcagaccagccagcgggcgaagaagactgcgcag
agcacggctcagtcggtacaaaatctggtgcccaccggcgggctgttctgggacgggcgg
gtcaataccctgcagcagcaggcgggtggcccgctgttcaacccggtggaaatggacgcg
ggcacgccgcagcgcgtggctgccatcatcgagcgccagccgtatgccaagacgtttttg
caactcttcggccccaatgtgtttgcagacccgaagcagacggtttccgaggcgctgttt
gcgatcgcccgttaccagatcgaagacccgcagttccacgccttcaacagcaagtacgac
gcctggctgcagggcagggcgactctgacgtcgcaggaaatgcgcggctatctggcgttc
aacgatgtgaacaagggcgattgcgctgcctgccatttggatcagccgaccaaggatcat
ctgccgccgctgttcaccgacacgcagtacgaggcgctgggcgtgccgcgtaatccgcag
attccggcgaaccagaacccgcactacttcgatatcgggctgtgcggccccttccggacc
gacctgaaaaaccagactgcctactgcggcatgttcctcacccccacgctgcgcaatgtg
gcgcagcggccggtgtatttccacaacggggtctatcactcgctcaagcaggtgctcgat
ttctacaacttccgcgacgtgcagccgggcagaatctaccccaccgtgggcggccaagtg
cgcaagtacgacgacctgccgccgcagtaccgcgccaatgtggacgtgaccgatccgccg
ctcaaccgcaagctgggcgaacaacccgcgatgaccgcgcaggacatgcgcgacatcatc
gccttcctgcacaccctgaacgacggttacacgccgctcaaaccagtttcatag

DBGET integrated database retrieval system