KEGG   Thiomonas intermedia: Tint_2707Help
Entry
Tint_2707         CDS       T01227                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tin  Thiomonas intermedia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tin00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tint_2707
Enzymes [BR:tin01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tint_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2879954..2880526)
Genome map
AA seq 190 aa AA seqDB search
MIGRLHGTLLDKSPPQILLDVGGVGYEVDVPMSTLYDLPAVGHAVTLLIHTVIREDAHLL
YGFATAGERSTFRELLKISGIGPRIALAVLSGLSVSEIAQAVTQQDAVRFTRVPGIGKKT
AERLLLELKGKLGADLGGAATAAAGSASDVLQALIALGYSEREAAAAAKALPEGCSVDDG
IRQALKSLAR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgactgcacggcaccctgctcgacaaatcccccccgcagattctgctcgac
gtgggcggcgtcggttatgaggtggacgtgccgatgagcacgctgtacgaccttcccgcg
gtggggcacgccgtcaccctgctcattcacaccgtcatccgagaagacgcgcatctgctc
tacggctttgctactgcgggggagcgcagcacgtttcgtgagctgctcaaaatcagcggc
atcggcccgcgcattgcgctggccgtgctctccgggctgagcgtgagcgagatcgctcaa
gccgtcacgcagcaggacgccgttcgctttacccgcgtgccgggcattggcaagaagacc
gctgaacgtctgctgcttgaactcaagggcaagctcggtgccgatctgggcggggccgca
acggccgccgcgggcagcgcctccgatgtgctgcaggccctcatcgcgctgggctattcc
gagcgcgaggcagcggccgccgccaaggcgctgccggaaggctgcagtgtggatgacggc
atccgccaggcgctgaaaagcctcgcgcgctga

DBGET integrated database retrieval system