KEGG   Thiomonas intermedia: Tint_2707Help
Entry
Tint_2707         CDS       T01227                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tin  Thiomonas intermedia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tin03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2879954..2880526)
Genome map
AA seq 190 aa AA seqDB search
MIGRLHGTLLDKSPPQILLDVGGVGYEVDVPMSTLYDLPAVGHAVTLLIHTVIREDAHLL
YGFATAGERSTFRELLKISGIGPRIALAVLSGLSVSEIAQAVTQQDAVRFTRVPGIGKKT
AERLLLELKGKLGADLGGAATAAAGSASDVLQALIALGYSEREAAAAAKALPEGCSVDDG
IRQALKSLAR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgactgcacggcaccctgctcgacaaatcccccccgcagattctgctcgac
gtgggcggcgtcggttatgaggtggacgtgccgatgagcacgctgtacgaccttcccgcg
gtggggcacgccgtcaccctgctcattcacaccgtcatccgagaagacgcgcatctgctc
tacggctttgctactgcgggggagcgcagcacgtttcgtgagctgctcaaaatcagcggc
atcggcccgcgcattgcgctggccgtgctctccgggctgagcgtgagcgagatcgctcaa
gccgtcacgcagcaggacgccgttcgctttacccgcgtgccgggcattggcaagaagacc
gctgaacgtctgctgcttgaactcaagggcaagctcggtgccgatctgggcggggccgca
acggccgccgcgggcagcgcctccgatgtgctgcaggccctcatcgcgctgggctattcc
gagcgcgaggcagcggccgccgccaaggcgctgccggaaggctgcagtgtggatgacggc
atccgccaggcgctgaaaagcctcgcgcgctga

DBGET integrated database retrieval system