KEGG   Thiomonas intermedia: Tint_2997Help
Entry
Tint_2997         CDS       T01227                                 

Definition
phenylacetic acid degradation protein paaN
Orthology
K02618  
oxepin-CoA hydrolase / 3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase [EC:3.3.2.12 1.17.1.7]
Organism
tin  Thiomonas intermedia
Pathway
Phenylalanine metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:tin00360]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3181686..3183740)
Genome map
AA seq 684 aa AA seqDB search
METPLLQSYLAGAWIGNTPAQILCDAATGAPVASTHAERPDFEAALAYGRGPGVRGLLSL
DFQERAQRLKSLAKFLGENKELLYRWSACTGATRADGWIDIDGGIGTLFAYASIGSNELP
GGNVIHEGPPIALGKKGHFVGSHILVPREGVAVHINAFNFPVWGLLEKFAPSFLAGMPCI
AKPATSTAYLTEALVRLMLQWGGLPEGSLQLVIGATGDLLDRLDGQDAVTFTGSATTAAT
LRANTNLITRGVPFNAEADSLNSAILAPDVNTEDAEFDVFADEVVREMRVKAGQKCTAIR
RILVPRRQLDALQTRLRQRLSALVVGDPRQAEVQMGPLASKAQQADVHSRLDMLRQVCST
VFDGANLPAMRSVETGDGAFAAPTLLMCEQPLQAEAVHEVEVFGPVATLLPYDDIDEALA
LAARGRGSLVTTLATRDPAIATHAARRAAVHHGRILVLDAEASMESTGHGSPLPYLKHGG
PGRAGGGEELGGVRAVVHYLQRAAIQGSPTMVGAVVGEYVRGGERIETEVHPFRRYFEEL
RIGESLLTHRRTVSEADIVAFGGISGDYFYMHFDAVAAAQSPFGQRIAHGYFVLSAAAGL
FVSPAPGPVLANYGLDTLRFVKPVRIGDTIRARLTCKRKIDRRKTDAQGRGQGVVAWDVE
VRNQDEELVASYDILTLVAKREGS
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcccttattacaaagctatctggccggcgcctggatcggcaacacccccgcg
cagattctgtgcgatgccgccaccggtgcaccggtggcctccacgcacgccgagcggcct
gatttcgaggcagctctggcctacggccgcggccccggcgtgcgcggcctgctctcgctt
gacttccaggagcgagcacagcgactcaagtcgctggcgaaattcctcggtgagaacaaa
gaactgctctaccgctggtcggcctgcaccggggccacccgcgccgacggctggattgac
attgatggcgggataggaacattgttcgcctacgcctcgattggcagcaacgaattacct
gggggtaacgtcatacacgaagggcctccgattgcgttgggcaagaagggacacttcgtc
ggcagccacatcctggtgccaagagaaggcgtggcggttcacattaacgcattcaatttc
ccggtttggggtttgctcgagaagtttgcaccgagctttctggccggtatgccttgcatc
gccaagccggctacaagcactgcctacctcaccgaagcgctggtgcggctgatgttgcaa
tggggcggactgcccgaaggcagcttgcaactggtcatcggcgcaaccggcgatctgctc
gaccgcctagacgggcaggacgcggtgaccttcaccggctctgcgacgaccgcagcgacg
cttcgcgccaataccaatctgatcactcgcggcgtgccgttcaacgccgaggcagattcg
ctcaacagcgctatcctcgcgccagacgtgaacaccgaagatgccgagttcgatgtgttc
gcggacgaggtcgttcgtgagatgcgggtcaaagccgggcagaaatgcaccgcgattcgg
cgcatcctggtgcctcgccgccagcttgacgccctgcagacgcggctgcgacaacgacta
tctgcgctggtggtaggtgaccccaggcaggccgaagtgcagatggggccgctcgccagc
aaagcgcagcaggctgacgtgcattcgcgactggatatgctgcgccaagtatgtagtacg
gtgttcgacggcgccaacttgcctgcgatgcgctctgtagagacgggtgacggcgccttc
gccgccccgacgttgctgatgtgcgagcaaccgctgcaagccgaagccgttcacgaggtc
gaggtgttcgggccggtcgccacgctgttgccttatgacgatatcgacgaggccttggcg
ctagctgcccgaggacgcggcagtctggtgactaccctcgctacgcgcgatcctgcgatt
gccacccatgccgcacgccgcgcagcggtccatcatggccgcatcctggtgctcgacgcc
gaagcgtcgatggaatcgaccggtcacggctcgccgctgccctatctcaagcacggtggc
ccggggcgcgcaggaggcggtgaggagcttggcggagtgcgcgcggtcgtgcattatcta
cagcgggcagcgatccagggatcgccgaccatggtcggcgccgtggtcggcgaatacgtc
cgcggaggtgaacgtatcgagaccgaagtgcaccctttccggcggtatttcgaggagctg
cggattggcgaatcgctgctcacccaccgacgcaccgttagcgaagcggatatcgtcgct
ttcggcggcatatccggagactacttctatatgcacttcgacgccgtcgctgcggcgcag
tcgcccttcggccagcgcatcgcacacggctatttcgtactctcagcagcggccggactg
tttgtctcgccggcacccggcccagtgctggcgaactacggcctagacacgctgcgcttc
gtcaaacccgtacgcatcggcgacaccatccgcgcgcggctgacttgtaagcgcaagata
gaccgccgcaagactgacgcccagggacgtggccagggggttgttgcgtgggatgtcgag
gtgcgcaaccaagacgaagagctggtcgcgagctacgacattctcacgctagtcgccaag
cgcgagggaagctga

DBGET integrated database retrieval system