KEGG   Thiomonas intermedia: Tint_3027Help
Entry
Tint_3027         CDS       T01227                                 

Definition
asparagine synthase family amidotransferase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tin  Thiomonas intermedia
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tin00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3206259..3208052
Genome map
AA seq 597 aa AA seqDB search
MCGICGELRFDGQAADLPAVERMRDALKPRGPDHAGQWHGGPVAFGHTRLSIIDLSQAGD
QPMRDADTGCVLVFNGVIYNYRALLGELGKLGRRFVSSGDTEVLLKAYAQWGEDCVRRLD
GMFAFALWDPRRQSLLLARDRFGMKPLYLAQDGTRLRFASSLPALLAAGGVDTAIDPVAL
HHLFSLHAVVPAPRTILRGVRKLEPAHTLRVQPDGMRWLARYWELNATRPDPLPSEREWI
GATRDTLQAALDSHVHAADVPVGVLLSGGLDSSLLVGMLAGEARNLRTYSIGFESLDADT
EKADEFEYSDLVAQTFGTRHHKLSIPNSAVLERLPQTIARMTEPMFSHDVVAFDLLAEWV
SCDVKAVLAGQGADEVFAGYFWYPRMQAEAGLPVERFSQHYVDRDHAEWLRFIDPAHHVP
DLTREFLESALQRPQGDSFLDQVLRLDVTTLIVDDPVKRVDNLPMAHALELRVPFLDRAL
VELAARMPPELRLQAGGKFPLKAVARGVLPDAVIDRPKGYFPVPALKHVRGPFLARMREL
LESRACRERGLYQRGFVDALLAAPEAPAHFTRIQGSKLWHAALLEWWLQIHVDGAAH
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatctgcggtgaattgcgcttcgacggccaggcggccgatcttcccgccgtc
gagcgcatgcgcgatgcgctcaagccccgcggacctgaccatgccggtcagtggcacggc
ggcccggtcgcgttcggacatacccgactgtcgatcatcgacctgagccaggcgggcgac
cagcccatgcgcgacgccgacaccggctgcgtgctggtgttcaacggcgtcatctacaac
taccgcgcgctgctcggcgaactgggcaagctgggccggcgcttcgtctccagcggcgat
accgaggtcctcctcaaggcctacgcgcagtggggcgaagactgtgtgcgccgactcgac
ggcatgttcgccttcgcgctgtgggacccacgccgccaaagcctgctgctggcacgcgac
cgcttcggcatgaagccgctctacctcgcgcaggacggcacgcggctgcgcttcgcatcg
agcctgccggcgctgctcgccgcaggtggcgtcgatactgcgatcgacccggtcgcgctg
catcacctgttttcgctgcacgccgtggtgccggcgcctcgtaccatcctgcgcggcgtg
cgcaagctggagccggcgcacaccctgcgcgtgcaacccgatggcatgcgctggctggcg
cgctactgggagctgaacgccacccgcccagacccgctgcccagcgaacgggagtggatc
ggcgccacgcgcgacacgctgcaggccgcgctcgacagccatgtgcacgcggccgacgtc
ccggtgggcgtgctgctgtccggcggcctggattcgagcctgctggtgggcatgctcgcg
ggcgaggcgcgcaatctgcgcacctattcaatcggcttcgaaagcctggatgccgacacc
gagaaggccgacgaattcgagtactccgatctcgtcgcgcagaccttcggcacccgccac
cacaaactgtccatccccaacagcgcggtgctcgagcgcctgccgcagaccatcgcgcgc
atgaccgagccgatgttcagccacgacgtcgtggccttcgatctgctcgccgaatgggtg
agctgcgacgtaaaggccgtgctcgccggccagggggccgacgaggtgttcgccggctat
ttctggtacccccgcatgcaagccgaggctggcctgccggtggagcgtttctcgcagcat
tacgtcgaccgcgatcatgcggaatggctgcgcttcatcgacccggcgcaccacgttccg
gacctcacgcgtgagtttctggagtccgctttgcagcgcccgcaaggcgactcctttctc
gaccaggtgctgcggctggacgtgaccaccctgatcgtcgacgacccggtcaaacgcgtt
gacaacctgccgatggcgcatgcgctggaactgcgcgtacccttcctcgaccgcgcgctg
gtcgagctggccgcccgcatgccacccgaactgcgcttgcaggcaggcggcaagtttccg
ctcaaggccgtcgcgcgcggggtgcttcccgatgccgtgatcgaccggcccaagggctac
tttcccgttcccgcgctcaagcacgtgcgcgggccgtttctggcgcgcatgcgggagctg
ctcgagtcgcgcgcctgccgcgagcgcgggctctaccagcgcggcttcgtcgatgctctg
ctcgccgcacccgaagcacctgcacacttcacccgcatccagggcagcaagctgtggcat
gccgccttgctggaatggtggctgcagatccacgtcgacggcgctgcacactga

DBGET integrated database retrieval system