KEGG   Thiomonas intermedia: Tint_3076Help
Entry
Tint_3076         CDS       T01227                                 

Definition
nickel-dependent hydrogenase large subunit
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
tin  Thiomonas intermedia
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tint_3076
Enzymes [BR:tin01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other acceptors
    1.12.99.6  hydrogenase (acceptor)
     Tint_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3257599..3259416)
Genome map
AA seq 605 aa AA seqDB search
MSTVTTPNGFTLDTSGRRVVVDPVTRIEGHMRCEVNVDKDNIIRNAVSTGTMWRGLEVIV
KGRDPRDVWAFVERICGVCTGCHALASVRAVEDALNIRIPKNAYLIREMMAKTLQVHDHV
VHFYHLHALDWVNPINALKADPKATSTLQQTVSPNHPQSSPGYFRDVQSRIKKFVDSGQL
GPFKNGYWSNPAYKLSPEADLMGVTHYLEALDMQREFVKVHTIFGGKNPHPNYLVGGVPC
AINMDGDLAAGAPLNMERLNFVRARIQEMVDFCHNVYVPDVIAIASFYKDWLYGGGLGAK
SVMDYGDYAKVQGDKSTDQMPGGVILNGNWNEVFEVDPRDPEQVQEFVSHSWYTYPGQEN
KGLHPWDGVTEPKFELGPNTKGSKTNIQEIDESAKYSWIKAPRWKGHAVEVGPLSRYTIA
YAKNLPHQREQVDRSVAFFNQLAGTSVDPKTALQTTIGRTLARALEAEYCADMMVDDWND
LIANIKAGDSSTANMEKWDPSTWPKEAKGVATVAAPRGALGHWIRIKDGRVENYQAVVPT
TWNGSPRDPAGNIGAFEASLMNTKMERPDEPVEILRTLHSFDPCLACSTHVMGEDGGELT
RVTVR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtgaccacgcccaacggctttaccctggacacctccgggcggcgcgtagtg
gtcgatccggtgacgcggatcgagggccacatgcgctgcgaagtcaacgtcgacaaggac
aacatcatccgcaatgcagtatccaccggcaccatgtggcgggggctggaggtcatcgtc
aaggggcgggacccgcgcgacgtgtgggccttcgtcgaacgcatctgcggcgtctgcacc
ggctgtcatgcgctggcctcggtgcgcgcggtggaagacgcgctgaacatccgcatcccg
aagaatgcctatctcattcgcgagatgatggccaagaccctgcaggtccacgaccacgtg
gtgcacttctaccacctgcatgccctggactgggttaacccgatcaacgccttgaaggca
gatccgaaggccacctcaacccttcagcagacggtgtcgcccaatcatccgcagtccagc
ccgggctactttcgcgacgtgcagtcgcgcatcaagaagttcgtggattcggggcagctc
ggtccgttcaagaacggctactggagcaacccggcctacaagctgtcaccggaggccgac
ctgatgggtgtcacccattatctcgaggcgctggacatgcagcgcgagttcgtgaaggtc
cacaccatcttcggcggcaagaacccgcaccccaactacctggtggggggggtgccctgc
gccatcaatatggacggcgacctggccgccggtgctccgctgaacatggagcgcctgaat
ttcgtgcgcgcccgcatccaggagatggtggatttctgccacaacgtctatgttcccgat
gtcattgccatcgccagcttctacaaggactggctctatggaggcggcctcggcgccaag
agcgtgatggactatggcgactacgccaaggtgcagggcgacaagtcgaccgaccagatg
cccggcggcgtcattctcaacggcaactggaacgaggtgttcgaggtcgatccgcgcgac
cccgagcaggttcaggagttcgtgagccactcctggtatacctatccgggacaggagaac
aagggcctgcacccctgggacggcgtgaccgagcccaagttcgagcttggccccaacacc
aagggaagcaagaccaacatccaggagattgacgagtcggccaagtactcatggatcaag
gcgccgcgctggaagggccatgcggtggaggtggggccgctgtcgcgctacaccatcgcc
tatgccaagaaccttccgcaccagcgcgagcaggtggaccgcagcgtggccttcttcaac
cagctcgccggcaccagtgtcgaccccaagacggcgttgcagaccaccatcggccgcact
ctggcgcgggcgctcgaagccgagtattgcgccgacatgatggtggacgactggaacgac
ctgatcgccaacatcaaggctggcgacagctcgactgcgaacatggagaagtgggatccg
agcacctggcccaaggaggccaagggcgtcgccacggtggccgcgccgcgtggcgcactg
ggtcactggatccgcatcaaggacgggagggtggagaactatcaggcggtggtgccgacc
acctggaatggttcgccgcgagatccggccggaaatatcggcgcctttgaagccagcctg
atgaacaccaagatggaacgacccgacgagcccgtcgaaattctgcgcactctgcacagc
ttcgatccctgcctcgcatgttccacccatgtgatgggcgaagacggcggcgaactcacc
cgggtgacggtgcgctga

DBGET integrated database retrieval system