KEGG   Thiomonas intermedia: Tint_3076Help
Entry
Tint_3076         CDS       T01227                                 

Definition
nickel-dependent hydrogenase large subunit
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
tin  Thiomonas intermedia
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tin00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3257599..3259416)
Genome map
AA seq 605 aa AA seqDB search
MSTVTTPNGFTLDTSGRRVVVDPVTRIEGHMRCEVNVDKDNIIRNAVSTGTMWRGLEVIV
KGRDPRDVWAFVERICGVCTGCHALASVRAVEDALNIRIPKNAYLIREMMAKTLQVHDHV
VHFYHLHALDWVNPINALKADPKATSTLQQTVSPNHPQSSPGYFRDVQSRIKKFVDSGQL
GPFKNGYWSNPAYKLSPEADLMGVTHYLEALDMQREFVKVHTIFGGKNPHPNYLVGGVPC
AINMDGDLAAGAPLNMERLNFVRARIQEMVDFCHNVYVPDVIAIASFYKDWLYGGGLGAK
SVMDYGDYAKVQGDKSTDQMPGGVILNGNWNEVFEVDPRDPEQVQEFVSHSWYTYPGQEN
KGLHPWDGVTEPKFELGPNTKGSKTNIQEIDESAKYSWIKAPRWKGHAVEVGPLSRYTIA
YAKNLPHQREQVDRSVAFFNQLAGTSVDPKTALQTTIGRTLARALEAEYCADMMVDDWND
LIANIKAGDSSTANMEKWDPSTWPKEAKGVATVAAPRGALGHWIRIKDGRVENYQAVVPT
TWNGSPRDPAGNIGAFEASLMNTKMERPDEPVEILRTLHSFDPCLACSTHVMGEDGGELT
RVTVR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtgaccacgcccaacggctttaccctggacacctccgggcggcgcgtagtg
gtcgatccggtgacgcggatcgagggccacatgcgctgcgaagtcaacgtcgacaaggac
aacatcatccgcaatgcagtatccaccggcaccatgtggcgggggctggaggtcatcgtc
aaggggcgggacccgcgcgacgtgtgggccttcgtcgaacgcatctgcggcgtctgcacc
ggctgtcatgcgctggcctcggtgcgcgcggtggaagacgcgctgaacatccgcatcccg
aagaatgcctatctcattcgcgagatgatggccaagaccctgcaggtccacgaccacgtg
gtgcacttctaccacctgcatgccctggactgggttaacccgatcaacgccttgaaggca
gatccgaaggccacctcaacccttcagcagacggtgtcgcccaatcatccgcagtccagc
ccgggctactttcgcgacgtgcagtcgcgcatcaagaagttcgtggattcggggcagctc
ggtccgttcaagaacggctactggagcaacccggcctacaagctgtcaccggaggccgac
ctgatgggtgtcacccattatctcgaggcgctggacatgcagcgcgagttcgtgaaggtc
cacaccatcttcggcggcaagaacccgcaccccaactacctggtggggggggtgccctgc
gccatcaatatggacggcgacctggccgccggtgctccgctgaacatggagcgcctgaat
ttcgtgcgcgcccgcatccaggagatggtggatttctgccacaacgtctatgttcccgat
gtcattgccatcgccagcttctacaaggactggctctatggaggcggcctcggcgccaag
agcgtgatggactatggcgactacgccaaggtgcagggcgacaagtcgaccgaccagatg
cccggcggcgtcattctcaacggcaactggaacgaggtgttcgaggtcgatccgcgcgac
cccgagcaggttcaggagttcgtgagccactcctggtatacctatccgggacaggagaac
aagggcctgcacccctgggacggcgtgaccgagcccaagttcgagcttggccccaacacc
aagggaagcaagaccaacatccaggagattgacgagtcggccaagtactcatggatcaag
gcgccgcgctggaagggccatgcggtggaggtggggccgctgtcgcgctacaccatcgcc
tatgccaagaaccttccgcaccagcgcgagcaggtggaccgcagcgtggccttcttcaac
cagctcgccggcaccagtgtcgaccccaagacggcgttgcagaccaccatcggccgcact
ctggcgcgggcgctcgaagccgagtattgcgccgacatgatggtggacgactggaacgac
ctgatcgccaacatcaaggctggcgacagctcgactgcgaacatggagaagtgggatccg
agcacctggcccaaggaggccaagggcgtcgccacggtggccgcgccgcgtggcgcactg
ggtcactggatccgcatcaaggacgggagggtggagaactatcaggcggtggtgccgacc
acctggaatggttcgccgcgagatccggccggaaatatcggcgcctttgaagccagcctg
atgaacaccaagatggaacgacccgacgagcccgtcgaaattctgcgcactctgcacagc
ttcgatccctgcctcgcatgttccacccatgtgatgggcgaagacggcggcgaactcacc
cgggtgacggtgcgctga

DBGET integrated database retrieval system