KEGG   Thermoanaerobacter italicus: Thit_0036Help
Entry
Thit_0036         CDS       T01178                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tit  Thermoanaerobacter italicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thit_0036
DNA repair and recombination proteins [BR:tit03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thit_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
42298..42897
Genome map
AA seq 199 aa AA seqDB search
MSYYSASLAKLIEELSKLPGIGPKTAQRLAFFIINMPIEEVKSLSQSIIDAKEKIKYCKI
CYNITDTEVCNICNDEERDNSLICVVSHPMDVVAMEKIREYKGVYHVLHGVISPIEGIGP
EDIKIKELLDRVKNGNVKEVILATNPDIEGEATAMYIAKLLKSLGVKVTRIAHGVPVGGD
LEYTDVVTLSRALEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagctattattcggcatctttagcaaaacttatagaagaattgtcaaagttgcctggt
ataggtcctaagacagcgcaaaggcttgcttttttcataataaacatgccgatagaagag
gtaaaaagtttatctcaatcgattatagatgctaaagaaaaaataaagtattgtaaaatt
tgttacaacataactgacacagaggtatgtaacatatgtaatgatgaagaaagagataat
tctcttatatgtgttgtttctcatcctatggacgttgtggcaatggagaaaatacgagaa
tataaaggagtgtatcatgtacttcatggtgttatttccccgatagaaggtataggacct
gaagatataaaaattaaagaacttttagacagagtgaaaaatgggaatgtaaaagaagta
atacttgctacaaatcccgatatagaaggagaagcaactgcaatgtacattgctaagcta
ctcaagtcattaggagtaaaggttacaagaattgcccatggagtgccagtaggcggtgac
cttgaatacactgatgttgtgactctttcaagggctttagaaggtagaagggaattgtaa

DBGET integrated database retrieval system