KEGG   Thermoanaerobacter italicus: Thit_0081Help
Entry
Thit_0081         CDS       T01178                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00010  Glycolysis / Gluconeogenesis
tit00052  Galactose metabolism
tit00500  Starch and sucrose metabolism
tit00520  Amino sugar and nucleotide sugar metabolism
tit00521  Streptomycin biosynthesis
tit01100  Metabolic pathways
tit01110  Biosynthesis of secondary metabolites
tit01120  Microbial metabolism in diverse environments
tit01130  Biosynthesis of antibiotics
tit01200  Carbon metabolism
Module
tit_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_0081
   00052 Galactose metabolism
    Thit_0081
   00500 Starch and sucrose metabolism
    Thit_0081
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_0081
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thit_0081
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thit_0081
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thit_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADD01409
JGI: Thit_0081
UniProt: D3T5A8
Position
101644..102591
Genome map
AA seq 315 aa AA seqDB search
MGRILCGVDLGGTKISTGLVDEKGTIIKSIKIPTMAEKGPEEVINRIERSIYDVLKETGL
KLSDLKGVGIGSPGPLDAKRGVVVSPPNLPGWDNVPIVDILSRKLELEVKLENDANAAAI
GEHLFGAGRGIDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTINFDGPRCNCGN
YGCFEAFASGTAIARFAQQGIQDGENTMIKDLAKDGVVKSEHVFEAAKLGDEFAKVLVDK
EAFYLGVGISNIMAFYNPKRVAIGGGVSTQWEMLYDKMMETIKEKALKPNAAVCEIVKAE
LGENVGVLGAAALLL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggggagaatcctatgcggtgttgacttaggagggacaaagataagtacaggccttgta
gatgagaagggcactattataaaaagcataaaaatacctactatggctgaaaaagggcca
gaagaagtgattaatcgaatagaacgaagtatctatgatgttttaaaggaaacagggttg
aaattatctgatttaaaaggggttggtattgggtctccagggccccttgatgctaaaagg
ggggtagttgtaagcccacctaatcttccgggttgggacaatgttcccattgtggatatt
ttatctcggaaacttgaacttgaagtaaaattagaaaatgatgcaaatgctgcagctatt
ggagaacatttgtttggcgcgggaagaggtatagacaattttgtgtacatcactgtaagc
actggaattggcggtggcgtgataatagaaggaaaactttatagcggagaaaattcaaat
gcagctgaaattgggcatcatactataaatttcgatggacctcgatgcaactgtggaaat
tatggctgctttgaagcctttgcttctggcacagctattgcaagatttgcacaacaagga
attcaagacggagagaatacaatgataaaggatttagccaaagatggagtggtaaaatcg
gaacatgtatttgaagcggcaaaattaggagacgagtttgcaaaagtattggtagacaag
gaagctttttatcttggagtgggaatatcaaatatcatggctttttataatccaaaaaga
gttgccataggtggtggcgtatctactcaatgggagatgctttatgataaaatgatggaa
acaataaaggaaaaagctttgaagccaaacgctgcggtgtgtgaaatagtaaaagcagag
cttggagaaaacgtgggtgttttaggagcggcagcattactcttataa

DBGET integrated database retrieval system