KEGG   Thermoanaerobacter italicus: Thit_0081Help
Entry
Thit_0081         CDS       T01178                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tit  Thermoanaerobacter italicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thit_0081
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_0081
   00052 Galactose metabolism
    Thit_0081
   00500 Starch and sucrose metabolism
    Thit_0081
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_0081
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thit_0081
   00524 Butirosin and neomycin biosynthesis
    Thit_0081
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thit_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
101644..102591
Genome map
AA seq 315 aa AA seqDB search
MGRILCGVDLGGTKISTGLVDEKGTIIKSIKIPTMAEKGPEEVINRIERSIYDVLKETGL
KLSDLKGVGIGSPGPLDAKRGVVVSPPNLPGWDNVPIVDILSRKLELEVKLENDANAAAI
GEHLFGAGRGIDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTINFDGPRCNCGN
YGCFEAFASGTAIARFAQQGIQDGENTMIKDLAKDGVVKSEHVFEAAKLGDEFAKVLVDK
EAFYLGVGISNIMAFYNPKRVAIGGGVSTQWEMLYDKMMETIKEKALKPNAAVCEIVKAE
LGENVGVLGAAALLL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggggagaatcctatgcggtgttgacttaggagggacaaagataagtacaggccttgta
gatgagaagggcactattataaaaagcataaaaatacctactatggctgaaaaagggcca
gaagaagtgattaatcgaatagaacgaagtatctatgatgttttaaaggaaacagggttg
aaattatctgatttaaaaggggttggtattgggtctccagggccccttgatgctaaaagg
ggggtagttgtaagcccacctaatcttccgggttgggacaatgttcccattgtggatatt
ttatctcggaaacttgaacttgaagtaaaattagaaaatgatgcaaatgctgcagctatt
ggagaacatttgtttggcgcgggaagaggtatagacaattttgtgtacatcactgtaagc
actggaattggcggtggcgtgataatagaaggaaaactttatagcggagaaaattcaaat
gcagctgaaattgggcatcatactataaatttcgatggacctcgatgcaactgtggaaat
tatggctgctttgaagcctttgcttctggcacagctattgcaagatttgcacaacaagga
attcaagacggagagaatacaatgataaaggatttagccaaagatggagtggtaaaatcg
gaacatgtatttgaagcggcaaaattaggagacgagtttgcaaaagtattggtagacaag
gaagctttttatcttggagtgggaatatcaaatatcatggctttttataatccaaaaaga
gttgccataggtggtggcgtatctactcaatgggagatgctttatgataaaatgatggaa
acaataaaggaaaaagctttgaagccaaacgctgcggtgtgtgaaatagtaaaagcagag
cttggagaaaacgtgggtgttttaggagcggcagcattactcttataa

DBGET integrated database retrieval system