KEGG   Thermoanaerobacter italicus: Thit_0201Help
Entry
Thit_0201         CDS       T01178                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tit  Thermoanaerobacter italicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tit00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tit00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
227236..228813
Genome map
AA seq 525 aa AA seqDB search
MKVNDMTLEEKIGQMLMVGFPLPIYDDHIEELISEYKIGNVILFSRNVKDKVQLQSLCNN
IQMNMIKHTGIPALIAIDQEGGMVTRIYKDATYLPGNMAIAATNNPENAYKIGEIEGKEL
RALGININFAPVLDVNNNPSNPVIGVRSYGENPEKVAEFGINYIKGLQKENVIATAKHFP
GHGDTSVDSHFDLPLVSHNKERLYRIELYPFKKAIENGVEAIMTAHILFLALEKNKLPAT
LSHNILTNILRKELRFNGVIITDCMEMNAIAKYFGTAKAAAMAIKAGADIVLVSHTKKLQ
IEVFNEIKEAVLRGEISIERIDESIERIIQLKEKYKLFENPYPDKNKIKTIVGCKEHQEI
AKNISLNSITIVKDENNLLPIKKQKILAVSPETVPVSGVDDTLMDKVSFAKAFVQKFGGV
EKTIPVNPDEDLINTIKEEAKDKEIVVVGAYNASLNEGQVRLVNSLWEVNKNIIVVALRN
PYDLLKFKDVPTYVCAYEYTPLSVESVLEVLSGNYVAKGELPVSL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaatgacatgaccttagaagaaaaaataggtcagatgctgatggttggtttt
ccgttgccgatttatgatgaccatattgaggagctgattagtgagtataaaatcggtaat
gtgattttattttctcgaaatgtaaaagataaagtacaacttcaaagtttatgcaataat
atccaaatgaatatgataaagcataccggtattccagctttaattgctattgaccaagaa
ggtggaatggttacgagaatttataaagatgctacttatttaccaggtaatatggctata
gcagctacaaataatcctgaaaatgcatataaaataggggagatagaaggtaaagagctt
agagcattgggcataaatattaattttgctcctgtccttgatgttaataataatccatct
aatcctgtaataggggttaggtcttatggagaaaatccagagaaagtagcggagttcgga
attaattatataaaaggtttacagaaagaaaatgttatagcgacagcgaagcattttcct
ggtcacggggatacttcagtagattctcattttgatttaccattggtgtctcacaataaa
gagcgattatatagaattgagttatatccttttaaaaaagcaatagaaaatggagtggaa
gccataatgacagcccatattctctttttagctcttgagaaaaataaattgcctgcaaca
ttgtcccataatattctcaccaatatactgagaaaggaacttagatttaacggagtaatt
ataaccgattgtatggaaatgaatgcaattgcaaaatattttggcacggccaaagcagct
gcgatggccataaaagcaggagcagatattgtccttgtttcccatacgaaaaaactgcag
atagaggtatttaatgaaatcaaagaggcagttttacgaggtgaaatatcaattgaaaga
atagatgaatctattgaaagaataatccaattgaaagagaaatacaaactttttgaaaat
ccatatccagataaaaataaaattaaaactattgtggggtgtaaagaacatcaagaaatt
gcaaaaaacataagtttgaatagcatcactattgttaaagacgaaaataaccttttacca
ataaagaaacaaaaaatattggcagtttctcctgaaacggtcccagtttcaggtgtggat
gatactttaatggataaagtatcttttgcaaaagcttttgtacaaaaatttggaggggtt
gaaaaaactattcctgtaaatcctgatgaagaccttataaatactatcaaagaagaggct
aaagataaagaaattgttgtagtaggcgcttataatgctagtttaaatgaaggccaagta
aggcttgtaaactcattgtgggaagtgaataaaaatatcatcgttgttgccttaagaaat
ccatatgatttattaaaatttaaagatgtacctacatatgtttgtgcttatgaatatact
ccactttctgtagaaagtgtgctagaggttttaagtggtaattatgtggcaaaaggagaa
ttgccggtttctttataa

DBGET integrated database retrieval system