KEGG   Thermoanaerobacter italicus: Thit_0261Help
Entry
Thit_0261         CDS       T01178                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tit  Thermoanaerobacter italicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thit_0261
   01230 Biosynthesis of amino acids
    Thit_0261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_0261
   00030 Pentose phosphate pathway
    Thit_0261
   00051 Fructose and mannose metabolism
    Thit_0261
   00052 Galactose metabolism
    Thit_0261
  Energy metabolism
   00680 Methane metabolism
    Thit_0261
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thit_0261
Protein phosphatases and associated proteins [BR:tit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thit_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
298167..299186
Genome map
AA seq 339 aa AA seqDB search
MKPIKRIAVIVSGGDAPGINSVLFGMISKNNDIEIYGFNGGYDGILNSEPIYFKDINLRQ
ANVSGNSILQTSRSAAPRTKEGRAKIIKRLKSLGIDTLIVCGGDGSLKAAELLTEEGMPC
LGIPLTIDNDIYGTEFTIGYNTAVKRVVDVLYNLHQTAHNMPGRIFMVEVFGGKSGHIAL
AGALAGGADIVIIPEMTRRPEDIASRIKEILKSKNDYVIIVCSESVYDTRDYIPGDQGIS
MEIGKKIEELIGMRVRHSVLGYFQRGGDPDPADSLLALQMGSFAIESIKNGKSGYMVGWN
HHRCVLVPLSKVVSNRKELDNNLLKIALEKEMIIGNEIM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctattaaaagaattgctgtcatagttagtggaggagatgcgccaggtattaat
tctgtattattcggtatgatcagcaaaaataacgatattgaaatatatggcttcaatggg
ggatatgatgggatattaaattcagaaccaatttattttaaagatattaatttaaggcag
gctaatgtaagtggtaattctattttacaaacttcaagaagtgctgcaccaagaactaaa
gaaggcagggcaaaaataattaaacgtcttaaatcacttggtatagatacacttatagta
tgtggcggagatggttctcttaaagcagctgaattattaactgaggaaggcatgccatgt
ttaggtattccattaactattgataatgatatatatggaacagaatttactattggttat
aatacagcagttaagagagtcgtagatgtattatataatttgcatcagacagctcataat
atgcccggaagaatttttatggtagaggtttttggggggaagtcaggacacattgcacta
gctggtgcactagcgggtggggcagacattgttataattcctgaaatgactagacggcct
gaagatattgcaagtaggatcaaggaaatactaaaaagtaaaaatgattatgtaataata
gtttgttcagagtctgtgtatgataccagagattatattcctggtgatcaaggaatatcc
atggaaataggcaaaaaaatagaagaactaataggcatgagggtaagacattcagtgtta
ggatattttcaacgaggaggagatcctgatccagctgattcattgttagcattacaaatg
ggcagttttgcaatagaaagtattaagaatggaaaatcaggatatatggttggatggaat
catcataggtgcgttttggttccgctatctaaggtagtatcaaatagaaaagaacttgat
aataatttgctaaagatagctttagaaaaagaaatgataattggaaatgaaattatgtaa

DBGET integrated database retrieval system